KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498372
Entry
107498372         CDS       T06036                                 

Gene name
JAG2
Definition
(RefSeq) LOW QUALITY PROTEIN: protein jagged-2
  KO
K21635  jagged-2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04330  Notch signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray05200  Pathways in cancer
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107498372 (JAG2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107498372 (JAG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498372 (JAG2)
  09162 Cancer: specific types
   05224 Breast cancer
    107498372 (JAG2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107498372 (JAG2)
SSDB
Motif
Pfam: EGF hEGF MNNL DSL EGF_2 EGF_CA
Other DBs
NCBI-GeneID: 107498372
NCBI-ProteinID: XP_015976882
LinkDB
Position
Unknown
AA seq 1081 aa
MRARGRGRLPRRLLLLLALCVQAARPMGYFELRLSALRNVNGELLNGACCDGDGRTTRAG
GCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARAR
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNGTTPDEELLIERVSHAGMVNPEDRWKS
LHFSGHVAQLELQFRVRCAENYYSPACNKFCRPRNDFFGHYSCDQYGNKACMDGWMGREC
KEAVCKQGCNLLHGGCAVPGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCEVNWG
GLLCNKDLNYCGSHHPCTNGGTCINAEPDQYHCACPAGYAGKNCERAEHACASNPCANGG
SCHEVASGFECHCPSGWSGLTCALDIDECASNPCAAGGTCVDRVDGFECICPEQWVGATC
QLDANECEGEPCLNAFSCKNLIGGYYCDCVPGWKGVNCHINVNDCPGQCQHGGTCKDLVH
GYQCVCPRGFGGRHCELQLDECASSPCRGGLCEDLVDGFRCHCPRGFSGPLCEVDTDFCE
PNPCQHGARCYSLDGDYYCACPDDVGGKNCSVPREPCPGGACGVIDGCGLQAGLWPDGRM
PCGPHGHCVSQPGGNFSCVCDSGFTGTYCHENVDDCLGQPCHNGGTCIDEVDAFRCFCPS
GWEGELCDTNPNDCLPDPCHSRGRCHDLVNDFYCVCDDGWKGKTCHSRESQCDANTCSNG
GTCYDQGDTFLCACLPGWKGSTCSIAQNSSCLPNPCVNGGTCVGSGDSFSCLCRDGWEGR
TCTHNTNDCSPLPCYNGGVCIDGVNWFRCACAPGFAGPDCRINIDECQSAPCAYGATCVD
EINGYRCSCPPGRAGPRCQDVIVFGRPCWSQGLPFPHGSSWVEDCNSCRCLDGHRDCSKV
WCGWKPCLLTGRPDSPSAQCPAGQWCQEKAPGQCLQPPCAAWGECGSAGPPLPSTSCLPS
SGHLDRNCARLTLHFDRAQGAPGGGLRTERQPAAPSSGDEDSLEVEKFLAHKLTKEPGGA
REAGPLGHGPQSGQPSTGAQPGLQEALTPGTVPGKEGGKSAPEKPYLPGLRGHRVHVPTA
S
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgcgggcgcggggccgggggcgcctgccccggcggctgctgttgctgttggcgctgtgc
gtgcaggcggcgcggcccatgggctatttcgagctgcggctgagcgcgctgcggaacgtg
aacggggagctgctgaacggcgcctgctgtgacggcgacggccggacgacgcgcgctggg
ggctgcggccacgacgagtgcgacacgtacgtgcgcgtgtgcctcaaggagtaccaggcc
aaggtgacgcccacggggccctgcagctacggccacggcgccacgcccgtgctggggggc
aactccttctacctgccgccggcgggcgccgcgggggaccgggcgcgggcacgggcccgg
gctggcggcgatcaggacccgggcctcgtcgtcatccccttccagttcgcctggccgcgc
tccttcaccctcatcgtggaggcctgggactgggacaacggcaccaccccggacgaggag
ctgctgatcgagcgggtgtcgcacgcgggcatggtgaaccccgaggaccgctggaagagc
ctgcacttcagcggccacgtggcgcagctggagctgcagttccgcgtgcgctgcgccgag
aactactacagccccgcctgcaacaagttctgccggccccgcaacgacttcttcggccac
tacagctgcgaccagtacggcaacaaggcctgcatggacggctggatgggcagggagtgc
aaggaagctgtgtgcaaacaaggctgcaacctgctccacgggggctgcgccgtgcccggc
gagtgcaggtgcagctacggctggcagggcaggttctgcgacgagtgcgtcccatacccg
ggctgcgtgcacggcagctgcgtggagccctggcagtgcaactgcgaggtcaactggggc
ggcctgctgtgcaacaaagacctgaactactgtggcagccaccacccctgcaccaacggg
ggcacgtgcatcaacgccgagcccgaccagtaccactgcgcgtgcccggccggctacgcg
ggcaagaactgcgagcgcgcagagcatgcctgcgcctccaacccctgcgccaacggcggc
tcctgccacgaggtggcctctggcttcgagtgccactgcccgtctggttggagtgggctc
acctgtgccctggacatcgacgagtgcgcctccaacccctgtgcggcagggggcacctgc
gtggaccgggtggacggcttcgagtgcatctgccctgagcagtgggtgggggccacctgc
cagctggacgccaatgagtgtgaaggggagccgtgccttaatgctttttcttgcaaaaac
ctgattggtggctattactgtgattgcgtcccgggctggaagggcgtcaactgccacatc
aacgtcaacgactgtcccgggcagtgtcagcacggtggcacgtgcaaggacctggttcac
ggctaccagtgcgtctgcccgaggggctttgggggccggcactgcgagctgcagctggac
gagtgcgccagcagcccctgccgcggcggcctctgcgaggacctggtggacggcttccgc
tgccactgcccgcgcggcttctccgggccgctctgcgaggtggacactgacttctgcgag
ccgaacccctgccagcacggggcccgctgctacagcctggacggcgactactactgcgcc
tgcccagacgacgtgggcggcaagaactgctcggtgccccgggagccgtgccccggcggg
gcctgcggagtgatcgacggctgcgggttgcaggcgggactctggccggacggcaggatg
ccctgcggcccccacggacactgtgtcagccagcccgggggcaacttctcgtgtgtctgt
gacagcggcttcactggcacctactgccacgagaatgtggacgactgcctgggccagccc
tgccacaacggcggcacctgcatcgacgaggtggacgccttccgctgcttctgccccagc
ggctgggagggcgagctctgtgacaccaatcccaacgactgcctccctgacccctgccac
agccgcggccgctgccacgacctggtcaacgacttctactgcgtgtgcgacgacggctgg
aagggcaagacctgccactcgcgcgagtcccagtgtgacgccaacacctgcagcaatggc
ggcacctgctacgaccaaggcgacaccttcctctgcgcctgcctccccggctggaagggc
agcacctgcagcattgcccagaacagcagctgcctgcccaatccctgcgtgaacggcggc
acgtgcgtgggcagcggggactccttctcctgcctctgccgcgatggctgggagggccgc
acctgcacgcacaataccaacgactgcagccctctgccttgctacaacggcggcgtctgc
atcgatggcgtcaactggttccgctgcgcgtgtgcacccggcttcgccggccccgactgc
cgcatcaacatcgacgagtgccagtcggcaccctgtgcctacggggccacgtgcgtggat
gagatcaacggctaccgctgcagctgcccaccgggccgggctggcccccggtgccaggac
gtgatcgtgttcgggaggccctgctggtcacagggcctgcccttcccgcacgggagctcc
tgggtggaggactgtaacagctgccgctgcctggatggccaccgggactgcagcaaggtg
tggtgtgggtggaagccctgcctgctgactggccggccggacagcccgagcgcccagtgc
ccagcagggcagtggtgccaggagaaggccccgggccagtgcctgcagccaccatgtgca
gcctggggcgagtgcggctccgcgggccccccgctgcccagcacatcctgcctgccgagc
tccggccacctggaccgcaactgtgcccgcctaactctgcacttcgaccgcgcccagggt
gccccagggggcggcctgcggacggaacgacagccggcggcccccagcagcggggacgag
gactccctggaggtggagaagttcctcgcgcacaaactcaccaaagagcccggcggcgcc
cgcgaggccggcccgctgggccacgggccccaaagtggacaaccctccacaggggcacag
ccaggtctgcaggaggccctgaccccagggactgtcccaggcaaagaaggtgggaagtct
gcccccgagaagccgtatttgccaggtttgcgtggacacagggtgcacgtgcccaccgcc
agctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507103
Entry
107507103         CDS       T06036                                 

Gene name
JAG1
Definition
(RefSeq) protein jagged-1 isoform X1
  KO
K06052  jagged-1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04330  Notch signaling pathway
ray04371  Apelin signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04668  TNF signaling pathway
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107507103 (JAG1)
   04371 Apelin signaling pathway
    107507103 (JAG1)
   04668 TNF signaling pathway
    107507103 (JAG1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107507103 (JAG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107507103 (JAG1)
  09162 Cancer: specific types
   05224 Breast cancer
    107507103 (JAG1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107507103 (JAG1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107507103 (JAG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107507103 (JAG1)
CD molecules [BR:ray04090]
 Proteins
  107507103 (JAG1)
SSDB
Motif
Pfam: EGF hEGF MNNL EGF_2 DSL EGF_CA cEGF EGF_3
Other DBs
NCBI-GeneID: 107507103
NCBI-ProteinID: XP_015993593
LinkDB
Position
Unknown
AA seq 1223 aa
MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQFRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNERNRI
ILPFSFAWPRSYTLLVEAWDSSNDTVQPDNIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNNAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNRGTCSNTGPDKYQCSCPDGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCEININDCLGQCQNDATCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINKFQCLCPTGFSGNLCQLDVDYCEPNPCQNGAQC
YNRASDYFCKCTEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGSCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEVSGRSCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPR
PCLIHKGHSDCPSGQSCIPILDDQCFVRPCTGVGECRSSSLQPVKTKCTSDAYYQDNCAN
ITFTFNKEMMSPGLTTEHVCSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAIFLFF
QSAEDIRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSS
VLTVAWICCLVTAFYWCVRKRRKPSSHARSASEDNTTNNVREQLNQIKNPIEKHGANTVP
IKDYENKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPARHPN
WTNKQDNRDLESAQSLNRMEYIV
NT seq 3672 nt   +upstreamnt  +downstreamnt
atgcgatccccacggacgcgcggccggcccgggcgccccctgagcctcctgctcgccctg
ctctgcgccctgcgagccaaggtgtgcggggcctccggccagttcgagttggagatcctg
tccatgcagaacgtgaacggggagctgcagaacgggaactgctgcggcggcgcccggaac
ccaggggaccgaaaatgcacccgcgacgagtgtgacacgtacttcaaagtgtgcctcaag
gagtaccagttccgcgtcacggccgggggtccctgcagcttcggctccgggtccactcct
gttatcgggggcaacacctttaacctcaaggctagtcgcggcaatgaacgcaaccgtatc
attctgcctttcagtttcgcctggccgaggtcctacactttacttgtggaggcgtgggat
tccagcaacgacactgtccaacctgacaacatcattgaaaaggcttctcactcgggcatg
ataaatcccagccgacagtggcagacgctaaagcagaacacaggggttgcccactttgaa
taccagatccgtgtgacgtgcgatgactattactatgggttcggctgcaataagttctgc
cgacccagagatgacttcttcggacactacgcctgtgaccagaatggcaacaaaacttgc
atggaaggctggatgggccctgaatgtaacaatgctatttgccgacaaggctgtagtcca
aagcatgggtcttgcaaactcccaggtgactgcaggtgtcagtatggctggcagggcctg
tactgtgacaaatgtatcccgcacccagggtgcgtccatggcacctgtaacgagccctgg
cagtgcctctgtgagaccaactggggcggtcagctctgcgacaaagatctcaattactgc
gggactcaccagccgtgtcttaatcggggaacttgtagcaacacgggtcctgacaaatac
cagtgttcctgccctgacggctattcaggacccaactgtgaaattgcagagcatgcctgc
ctctctgatccctgccacaacagaggcagctgcaaggagacctccctggggtttgagtgt
gagtgttctccaggctggacgggacccacctgctccacaaacattgatgactgttctcca
aataactgttcccatgggggcacctgccaagacttggttaacggatttaagtgcgtgtgc
ccgcctcagtggactggcaaaacgtgccagttagatgcaaatgaatgtgaggccaaacct
tgtgtcaatgccaaatcctgtaagaatctgattgccagctactactgtgattgcctcccg
ggctggatgggtcagaattgtgaaataaatattaatgactgtcttggccagtgtcagaat
gacgccacctgtcgggatttggttaatggttatcgctgtatctgtccacctggctatgca
ggcgatcactgtgagagagacatcgatgaatgtgccagcaacccctgtttgaatgggggt
cactgtcagaatgaaatcaacaaattccagtgtctgtgtcccactggtttctctggaaac
ctctgtcagctggacgtagattattgtgagccaaatccctgccagaacggtgcccagtgc
tacaaccgtgccagtgactatttctgcaagtgtactgaggactacgaaggcaagaactgc
tcccaccttaaagaccactgccgcacgaccccctgcgaagtgattgacagctgcacagtg
gccatggcttccaatgacacgcctgaaggcgtgcggtatatttcctcgaacgtctgtggt
ccccatgggaagtgcaagagtcagtcaggaggcaaattcacctgcgactgcaacaaaggc
ttcactgggacatactgccatgaaaatattaatgactgtgagagcaacccctgtaaaaat
ggtggcacttgcattgatggcgtcaactcctacaagtgtatctgtagtgacggctgggag
ggggcctactgtgaaaccaacattaatgactgcagccagaacccctgccacaatgggggc
tcatgtcgtgacctggtcaatgacttctactgtgactgtaaaaacgggtggaaaggaaag
acctgccactcgcgtgacagccaatgtgatgaggccacgtgcaacaatggcggcacctgc
tatgacgaaggagatgctttcaagtgcatgtgtcctggaggctgggaaggaacaacctgc
aacatagcccgaaatagtagctgcctacccaacccctgccataacgggggcacctgtgtg
gtcaacggcgagtccttcacctgtgtctgcaaagaaggctgggaggggcccatctgtact
cagaataccaatgactgcagtcctcacccctgctacaacagcggcacatgcgtggatgga
gacaactggtaccggtgtgaatgcgcccctggttttgctgggcctgactgcagaataaac
attaacgaatgccagtcttcaccttgtgccttcggggcaacctgcgtggatgagatcaat
ggctaccgttgtgtctgccccccagggcacagtggtgccaagtgccaggaagtttcaggg
agatcttgcatcaccatggggagtgtgatcccggatggggccaagtgggatgatgactgc
aatacctgccagtgcctgaatggaaggatcgcctgctccaaggtctggtgtggccctcga
ccttgcctcatccacaaagggcacagtgattgccccagtgggcagagctgcatccccatc
ctggatgaccagtgttttgtccgcccctgcactggcgtgggcgagtgtcgctcttccagt
ctccagccggtgaagaccaaatgtacttctgatgcctattaccaggataactgcgcaaac
atcacattcaccttcaacaaagagatgatgtccccgggtcttaccacggagcatgtttgc
agtgagttgaggaatttgaatattttgaagaatgtttctgccgaatattcaatctacata
gcctgtgagccttccccttctgcaaacaatgaaatacatgtggccatttttttatttttc
cagtctgctgaagacatacgggatgatggaaaccctatcaaggaaatcactgacaaaatt
atagaccttgttagtaaacgtgatgggaacagctctcttatcgctgccgttgcggaagtg
agagttcagaggcgtcctctgaagaacagaacggatttcctggtccctctgctgagctct
gtcctgactgtggcttggatctgttgcttggtgacggccttctactggtgtgtgcggaag
cgacggaagcccagcagccacgcccgctcagcctccgaggacaacaccaccaacaacgtg
agggagcagctgaaccagatcaaaaaccccatcgagaagcatggggccaacacggtccct
atcaaggattacgagaacaaaaactccaaaatgtcgaaaataaggacacacaactcggag
gtggaggaggatgacatggacaagcaccagcagaaagcccggtttgccaagcagccagcg
tacacgctggtagacagagaggagaagccccccaacggcacgccggccagacacccaaac
tggacaaacaaacaggacaacagagacctggagagcgcccagagcttaaaccgaatggag
tacatcgtatag

DBGET integrated database retrieval system