KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498386
Entry
107498386         CDS       T06036                                 

Gene name
NRG3
Definition
(RefSeq) LOW QUALITY PROTEIN: pro-neuregulin-3, membrane-bound isoform
  KO
K05457  neuregulin 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04012  ErbB signaling pathway
ray05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107498386 (NRG3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    107498386 (NRG3)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107498386 (NRG3)
SSDB
Motif
Pfam: EGF Laminin_EGF LapA_dom EGF_2
Other DBs
NCBI-GeneID: 107498386
NCBI-ProteinID: XP_015976937
LinkDB
Position
Unknown
AA seq 724 aa
MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVWN
RQQTWLCVVPLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSSF
PKAMETTTTTTSTTSPATPPAGGTASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPRS
TTARNTAVPPTVLSTTAPSFSSSTPGSRPPMPGTPSTQAMPSWPTAAFATSSYLHDSTPS
WTLSPFQDAAATAAAASTTTLSSSSTTTTPETSTRPKFHTTTYSTERSEHFKPCRDKDLA
YCLNDGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFMESEEV
YQRQVLSISCIIFGIIIVGMFCAAFYFKSKKQAKQFQEQLKEPQNGKNYSLKATSTMAKS
DNFMKNHVQLQNYSKAERHPVTALEKMMESSFAGPQSFPEVPSPDRGSQSVKHHRSLSSC
CSPGQRSCVLHRNAFRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTMPCQGIEVRKTIS
HLPIQLWCVERSLDLKYSSNGLKNQQNASINMQLPSRETNSYFNSLDQKDLMGYSSTRAS
SVPIIPSVGLEETCMQMPGISEVKSIKWCKNSFSADIVNVSIPVSDCLTAEQQEVKILLE
TVQEQIRILTDARRSEDYELASVETEDSASENTAFLPLSPTAKSERETQFVLRNEIQRDS
ALIK
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgaaggggcggccgctgcctcgccacctggagccgcttcggcagccgccgcctcg
gccgaggagggcaccgcggcggctgcggcggcggcagcgggcgggggcccggacggcggc
ggcgaaggggcggccgagcccccccgggagttacgctgtagcgactgcatcgtgtggaac
cggcagcagacgtggctgtgcgtggtgcctctgttcatcggcttcatcggcctggggctc
agcctcatgctcctcaaatggatcgtggtgggctccgtcaaggaatacgtgcccaccgac
ctggtggactccaaggggatgggccaggaccccttctttctctccaagcccagctccttc
cccaaggccatggagaccaccaccacgaccacttccaccacgtcccccgctacccccccc
gcaggaggcaccgcctcttccaggacgcccaacaggattagtactcgcttgaccaccatt
acgagggcgcccactcgcttccccgggcaccgggtacccattcgggccagcccccgctcc
accaccgcacggaacactgcagtccccccgacggtcctgtccaccacggctccttccttc
agtagcagcacgccgggttcccgacccccaatgccaggaacccccagtacccaggcaatg
ccctcctggcccactgcggcattcgctacctcctcctaccttcatgattctactccctcc
tggaccctgtctccttttcaggatgccgccgccactgccgccgccgcctccaccaccact
ttgtcttcctcctctaccaccaccacgccagaaactagcaccaggcccaaatttcatacg
acgacatattccacagaacggtccgagcactttaaaccctgccgagacaaggacctcgca
tactgtctcaatgatggcgagtgctttgtgatcgaaaccctgaccggatcccataaacac
tgtcggtgcaaagaaggctaccaaggagtccgttgtgatcaattcctgccaaaaactgat
tccatcttatcggatccaacagaccatttggggattgaattcatggagagtgaagaagtt
tatcaaaggcaggtgctgtcaatttcatgtatcatctttggaattatcatcgtgggcatg
ttctgtgcagcattctacttcaaaagcaagaaacaagctaaacaatttcaagagcagctg
aaagagccacaaaatggtaaaaactatagtctcaaagcaaccagcacaatggcaaagtca
gataacttcatgaagaatcatgtccagctgcaaaattattcaaaagcggaaagacatcct
gtgactgcattggagaaaatgatggagtcaagctttgctggcccccagtcattcccagag
gtcccttctcctgacagaggaagccaatctgtcaaacaccacaggagtctctcctcttgc
tgcagcccagggcaaaggagctgcgtgctccataggaatgccttcagaaggacaccacct
tcacctcgaagtaggctgggtggaattgtgggaccggcatatcagcaactggaggaatca
agaatcccagaccaggatacaatgccttgccaagggatagaggtgaggaagactatatcc
cacctgcctatacagctgtggtgtgttgaaagatcactggacttaaagtattcatctaat
ggtttaaaaaaccaacaaaatgcatcaataaatatgcaactgccttcaagagagacaaac
tcctattttaatagcttggatcaaaaggacttgatgggatattcatccacaagggccagt
tccgtgcccatcatcccttcagtgggtctagaagaaacctgcatgcaaatgccagggatt
tctgaagtcaaaagcatcaaatggtgcaaaaactccttctctgctgatatcgtcaatgtg
agtattccagtcagtgattgtctcacagcagaacaacaagaagtgaaaatattgctagaa
actgtccaggagcagatccgaattctgactgatgccaggcggtcagaagactacgaactg
gccagcgtagaaactgaggacagtgcaagtgaaaacacagcctttctccccctgagtccc
acagccaaatcggaacgagagacacaatttgtcttaagaaatgaaatacaaagagactct
gcattgatcaagtga

DBGET integrated database retrieval system