KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498395
Entry
107498395         CDS       T06036                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04218  Cellular senescence
ray04261  Adrenergic signaling in cardiomyocytes
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04668  TNF signaling pathway
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04910  Insulin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04920  Adipocytokine signaling pathway
ray04922  Glucagon signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04926  Relaxin signaling pathway
ray04929  GnRH secretion
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05017  Spinocerebellar ataxia
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107498395 (AKT1)
   04012 ErbB signaling pathway
    107498395 (AKT1)
   04014 Ras signaling pathway
    107498395 (AKT1)
   04015 Rap1 signaling pathway
    107498395 (AKT1)
   04370 VEGF signaling pathway
    107498395 (AKT1)
   04371 Apelin signaling pathway
    107498395 (AKT1)
   04630 JAK-STAT signaling pathway
    107498395 (AKT1)
   04668 TNF signaling pathway
    107498395 (AKT1)
   04066 HIF-1 signaling pathway
    107498395 (AKT1)
   04068 FoxO signaling pathway
    107498395 (AKT1)
   04072 Phospholipase D signaling pathway
    107498395 (AKT1)
   04071 Sphingolipid signaling pathway
    107498395 (AKT1)
   04024 cAMP signaling pathway
    107498395 (AKT1)
   04022 cGMP-PKG signaling pathway
    107498395 (AKT1)
   04151 PI3K-Akt signaling pathway
    107498395 (AKT1)
   04152 AMPK signaling pathway
    107498395 (AKT1)
   04150 mTOR signaling pathway
    107498395 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107498395 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    107498395 (AKT1)
   04218 Cellular senescence
    107498395 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107498395 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107498395 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107498395 (AKT1)
   04613 Neutrophil extracellular trap formation
    107498395 (AKT1)
   04620 Toll-like receptor signaling pathway
    107498395 (AKT1)
   04625 C-type lectin receptor signaling pathway
    107498395 (AKT1)
   04660 T cell receptor signaling pathway
    107498395 (AKT1)
   04662 B cell receptor signaling pathway
    107498395 (AKT1)
   04664 Fc epsilon RI signaling pathway
    107498395 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    107498395 (AKT1)
   04062 Chemokine signaling pathway
    107498395 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107498395 (AKT1)
   04922 Glucagon signaling pathway
    107498395 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    107498395 (AKT1)
   04920 Adipocytokine signaling pathway
    107498395 (AKT1)
   04929 GnRH secretion
    107498395 (AKT1)
   04915 Estrogen signaling pathway
    107498395 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    107498395 (AKT1)
   04917 Prolactin signaling pathway
    107498395 (AKT1)
   04926 Relaxin signaling pathway
    107498395 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    107498395 (AKT1)
   04919 Thyroid hormone signaling pathway
    107498395 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107498395 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107498395 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    107498395 (AKT1)
   04728 Dopaminergic synapse
    107498395 (AKT1)
   04722 Neurotrophin signaling pathway
    107498395 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107498395 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    107498395 (AKT1)
   04213 Longevity regulating pathway - multiple species
    107498395 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498395 (AKT1)
   05205 Proteoglycans in cancer
    107498395 (AKT1)
   05230 Central carbon metabolism in cancer
    107498395 (AKT1)
   05231 Choline metabolism in cancer
    107498395 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107498395 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107498395 (AKT1)
   05212 Pancreatic cancer
    107498395 (AKT1)
   05225 Hepatocellular carcinoma
    107498395 (AKT1)
   05226 Gastric cancer
    107498395 (AKT1)
   05214 Glioma
    107498395 (AKT1)
   05221 Acute myeloid leukemia
    107498395 (AKT1)
   05220 Chronic myeloid leukemia
    107498395 (AKT1)
   05218 Melanoma
    107498395 (AKT1)
   05211 Renal cell carcinoma
    107498395 (AKT1)
   05215 Prostate cancer
    107498395 (AKT1)
   05213 Endometrial cancer
    107498395 (AKT1)
   05224 Breast cancer
    107498395 (AKT1)
   05222 Small cell lung cancer
    107498395 (AKT1)
   05223 Non-small cell lung cancer
    107498395 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107498395 (AKT1)
   05017 Spinocerebellar ataxia
    107498395 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107498395 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107498395 (AKT1)
   04931 Insulin resistance
    107498395 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107498395 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107498395 (AKT1)
   05135 Yersinia infection
    107498395 (AKT1)
   05152 Tuberculosis
    107498395 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498395 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    107498395 (AKT1)
   05161 Hepatitis B
    107498395 (AKT1)
   05160 Hepatitis C
    107498395 (AKT1)
   05164 Influenza A
    107498395 (AKT1)
   05162 Measles
    107498395 (AKT1)
   05168 Herpes simplex virus 1 infection
    107498395 (AKT1)
   05163 Human cytomegalovirus infection
    107498395 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107498395 (AKT1)
   05169 Epstein-Barr virus infection
    107498395 (AKT1)
   05165 Human papillomavirus infection
    107498395 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107498395 (AKT1)
   05142 Chagas disease
    107498395 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107498395 (AKT1)
   01524 Platinum drug resistance
    107498395 (AKT1)
   01522 Endocrine resistance
    107498395 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107498395 (AKT1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107498395 (AKT1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107498395 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 107498395
NCBI-ProteinID: XP_015976951
LinkDB
Position
Unknown
AA seq 485 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPSDNSGAEEMEVSVAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGEAPRPTA
VLHLSRERVFPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGL
CKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYSQDHE
KLFELILVGEIRFPRSLGPEARALLSGLLKKDPKQRLGGGPEDAKEIMQHRFFAGIVWRD
VYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDNMECVDSERRPHFPQFSYS
ASGTA
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggctggctgcacaaacgaggggagtacatcaag
acctggaggccgcggtacttcctcctcaagaatgacggcaccttcatcggctacaaggag
cggccgcaggacgtggagcagcgcgagtcacccctcaacaacttctccgtggcacaatgc
cagctgatgaagacggagcggcctcggcccaacaccttcatcatccgctgcctgcagtgg
accacggtcatcgagcgcaccttccacgtggagacgcccgaggagcgggaggagtggacg
accgccatccagaccgtggccgacgggctcaagaggcaggaggaggagatgatggacttc
cggtcgggctcgcccagcgacaactcgggggccgaggagatggaggtgtcagtggccaag
cccaagcaccgcgtgaccatgaatgagttcgagtacctgaagctgctgggcaaaggcacc
ttcgggaaggtgatcctggtgaaggagaaggccacgggccgctactatgccatgaagatc
ctgaagaaggaggtcatcgtggccaaggacgaggtggcgcacacgctcacggagaaccgc
gtcctgcagaactcccggcaccctttcctgacggccctgaagtactccttccagacccac
gaccgcctctgcttcgtcatggagtacgccaacggcggcgaggctcctcgtcccacagct
gttcttcacctgtcgcgggagcgggtgtttcccgaggaccgcgcccgcttctacggcgcc
gagatcgtgtcggccctggactacctgcactcggagaagaacgtggtctaccgcgacctc
aagctggagaacctcatgctggacaaggacgggcacatcaagatcactgacttcgggctg
tgcaaggagggcatcaaagacggcgccaccatgaagaccttctgcgggacccccgagtac
ctggcccccgaggtgctggaggacaacgactacggccgggcggtggactggtgggggctg
ggcgtggtcatgtacgagatgctgtgcggccgcctgcccttctacagccaggaccacgag
aagctctttgagctcatcctcgtgggcgagatccgcttcccgcgctcgctcggccccgag
gccagggccctgctgtcggggctgctcaagaaggaccccaagcagaggctgggagggggc
cccgaggacgccaaggagatcatgcagcaccgcttcttcgccggcatcgtgtggcgggac
gtgtacgagaagaagctcagtccgcccttcaagccccaggtcacgtcagagacggacact
aggtactttgacgaggagtttacggcccagatgatcaccatcacgccaccggaccaagac
gacaacatggagtgcgtggacagcgagcggaggccccacttcccacagttctcctactcg
gccagcggcacggcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513978
Entry
107513978         CDS       T06036                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04218  Cellular senescence
ray04261  Adrenergic signaling in cardiomyocytes
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04668  TNF signaling pathway
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04910  Insulin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04920  Adipocytokine signaling pathway
ray04922  Glucagon signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04926  Relaxin signaling pathway
ray04929  GnRH secretion
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05017  Spinocerebellar ataxia
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107513978 (AKT3)
   04012 ErbB signaling pathway
    107513978 (AKT3)
   04014 Ras signaling pathway
    107513978 (AKT3)
   04015 Rap1 signaling pathway
    107513978 (AKT3)
   04370 VEGF signaling pathway
    107513978 (AKT3)
   04371 Apelin signaling pathway
    107513978 (AKT3)
   04630 JAK-STAT signaling pathway
    107513978 (AKT3)
   04668 TNF signaling pathway
    107513978 (AKT3)
   04066 HIF-1 signaling pathway
    107513978 (AKT3)
   04068 FoxO signaling pathway
    107513978 (AKT3)
   04072 Phospholipase D signaling pathway
    107513978 (AKT3)
   04071 Sphingolipid signaling pathway
    107513978 (AKT3)
   04024 cAMP signaling pathway
    107513978 (AKT3)
   04022 cGMP-PKG signaling pathway
    107513978 (AKT3)
   04151 PI3K-Akt signaling pathway
    107513978 (AKT3)
   04152 AMPK signaling pathway
    107513978 (AKT3)
   04150 mTOR signaling pathway
    107513978 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107513978 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    107513978 (AKT3)
   04218 Cellular senescence
    107513978 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107513978 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    107513978 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107513978 (AKT3)
   04613 Neutrophil extracellular trap formation
    107513978 (AKT3)
   04620 Toll-like receptor signaling pathway
    107513978 (AKT3)
   04625 C-type lectin receptor signaling pathway
    107513978 (AKT3)
   04660 T cell receptor signaling pathway
    107513978 (AKT3)
   04662 B cell receptor signaling pathway
    107513978 (AKT3)
   04664 Fc epsilon RI signaling pathway
    107513978 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    107513978 (AKT3)
   04062 Chemokine signaling pathway
    107513978 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107513978 (AKT3)
   04922 Glucagon signaling pathway
    107513978 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    107513978 (AKT3)
   04920 Adipocytokine signaling pathway
    107513978 (AKT3)
   04929 GnRH secretion
    107513978 (AKT3)
   04915 Estrogen signaling pathway
    107513978 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    107513978 (AKT3)
   04917 Prolactin signaling pathway
    107513978 (AKT3)
   04926 Relaxin signaling pathway
    107513978 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    107513978 (AKT3)
   04919 Thyroid hormone signaling pathway
    107513978 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107513978 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107513978 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    107513978 (AKT3)
   04728 Dopaminergic synapse
    107513978 (AKT3)
   04722 Neurotrophin signaling pathway
    107513978 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107513978 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    107513978 (AKT3)
   04213 Longevity regulating pathway - multiple species
    107513978 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513978 (AKT3)
   05205 Proteoglycans in cancer
    107513978 (AKT3)
   05230 Central carbon metabolism in cancer
    107513978 (AKT3)
   05231 Choline metabolism in cancer
    107513978 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107513978 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107513978 (AKT3)
   05212 Pancreatic cancer
    107513978 (AKT3)
   05225 Hepatocellular carcinoma
    107513978 (AKT3)
   05226 Gastric cancer
    107513978 (AKT3)
   05214 Glioma
    107513978 (AKT3)
   05221 Acute myeloid leukemia
    107513978 (AKT3)
   05220 Chronic myeloid leukemia
    107513978 (AKT3)
   05218 Melanoma
    107513978 (AKT3)
   05211 Renal cell carcinoma
    107513978 (AKT3)
   05215 Prostate cancer
    107513978 (AKT3)
   05213 Endometrial cancer
    107513978 (AKT3)
   05224 Breast cancer
    107513978 (AKT3)
   05222 Small cell lung cancer
    107513978 (AKT3)
   05223 Non-small cell lung cancer
    107513978 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107513978 (AKT3)
   05017 Spinocerebellar ataxia
    107513978 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107513978 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107513978 (AKT3)
   04931 Insulin resistance
    107513978 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107513978 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107513978 (AKT3)
   05135 Yersinia infection
    107513978 (AKT3)
   05152 Tuberculosis
    107513978 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107513978 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    107513978 (AKT3)
   05161 Hepatitis B
    107513978 (AKT3)
   05160 Hepatitis C
    107513978 (AKT3)
   05164 Influenza A
    107513978 (AKT3)
   05162 Measles
    107513978 (AKT3)
   05168 Herpes simplex virus 1 infection
    107513978 (AKT3)
   05163 Human cytomegalovirus infection
    107513978 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107513978 (AKT3)
   05169 Epstein-Barr virus infection
    107513978 (AKT3)
   05165 Human papillomavirus infection
    107513978 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107513978 (AKT3)
   05142 Chagas disease
    107513978 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107513978 (AKT3)
   01524 Platinum drug resistance
    107513978 (AKT3)
   01522 Endocrine resistance
    107513978 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107513978 (AKT3)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107513978 (AKT3)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107513978 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 107513978
NCBI-ProteinID: XP_016006736
LinkDB
Position
Unknown
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDSERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctattcaggctgtagcagacagacttcagaggcaagaagaagagagaatgaactgtagt
ccaacttcacagattgataacataggggaggaagagatggacgcttctacaactcatcat
aaaagaaagactatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtgggaaatattatgcaatgaagattctgaag
aaagaagttattattgcaaaggatgaagtggcgcacactctaaccgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgcgagag
cgggtgttctccgaggaccgcacgcgcttctatggagcagagattgtctctgccttggac
tatctgcattccgggaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaattacggattttggactttgcaaagaagggatcacagacgca
gccaccatgaagacgttctgtggcacaccagagtacctggcgccagaggtgttggaagat
aatgactacggccgggcagtggactggtggggcctcggcgtcgtcatgtatgagatgatg
tgtgggaggttgcctttctacaaccaggatcacgagaaacttttcgaactaatactaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggcgggggaccagatgatgcaaaagaaattatg
agacacagtttcttctccggagtaaactggcaagatgtatatgacaaaaagcttgtacct
ccttttaagcctcaagtaacatccgagacagataccagatattttgatgaagaatttaca
gctcagactattacaataacaccaccggaaaaatacgacgaggacggcatggactgcgtg
gacagcgagcggcggccgcacttcccgcagttctcctactccgccagcggacgcgaatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521783
Entry
107521783         CDS       T06036                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04218  Cellular senescence
ray04261  Adrenergic signaling in cardiomyocytes
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04668  TNF signaling pathway
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04910  Insulin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04920  Adipocytokine signaling pathway
ray04922  Glucagon signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04926  Relaxin signaling pathway
ray04929  GnRH secretion
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05017  Spinocerebellar ataxia
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107521783 (AKT2)
   04012 ErbB signaling pathway
    107521783 (AKT2)
   04014 Ras signaling pathway
    107521783 (AKT2)
   04015 Rap1 signaling pathway
    107521783 (AKT2)
   04370 VEGF signaling pathway
    107521783 (AKT2)
   04371 Apelin signaling pathway
    107521783 (AKT2)
   04630 JAK-STAT signaling pathway
    107521783 (AKT2)
   04668 TNF signaling pathway
    107521783 (AKT2)
   04066 HIF-1 signaling pathway
    107521783 (AKT2)
   04068 FoxO signaling pathway
    107521783 (AKT2)
   04072 Phospholipase D signaling pathway
    107521783 (AKT2)
   04071 Sphingolipid signaling pathway
    107521783 (AKT2)
   04024 cAMP signaling pathway
    107521783 (AKT2)
   04022 cGMP-PKG signaling pathway
    107521783 (AKT2)
   04151 PI3K-Akt signaling pathway
    107521783 (AKT2)
   04152 AMPK signaling pathway
    107521783 (AKT2)
   04150 mTOR signaling pathway
    107521783 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107521783 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    107521783 (AKT2)
   04218 Cellular senescence
    107521783 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107521783 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    107521783 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107521783 (AKT2)
   04613 Neutrophil extracellular trap formation
    107521783 (AKT2)
   04620 Toll-like receptor signaling pathway
    107521783 (AKT2)
   04625 C-type lectin receptor signaling pathway
    107521783 (AKT2)
   04660 T cell receptor signaling pathway
    107521783 (AKT2)
   04662 B cell receptor signaling pathway
    107521783 (AKT2)
   04664 Fc epsilon RI signaling pathway
    107521783 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    107521783 (AKT2)
   04062 Chemokine signaling pathway
    107521783 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107521783 (AKT2)
   04922 Glucagon signaling pathway
    107521783 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    107521783 (AKT2)
   04920 Adipocytokine signaling pathway
    107521783 (AKT2)
   04929 GnRH secretion
    107521783 (AKT2)
   04915 Estrogen signaling pathway
    107521783 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    107521783 (AKT2)
   04917 Prolactin signaling pathway
    107521783 (AKT2)
   04926 Relaxin signaling pathway
    107521783 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    107521783 (AKT2)
   04919 Thyroid hormone signaling pathway
    107521783 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107521783 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107521783 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    107521783 (AKT2)
   04728 Dopaminergic synapse
    107521783 (AKT2)
   04722 Neurotrophin signaling pathway
    107521783 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107521783 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    107521783 (AKT2)
   04213 Longevity regulating pathway - multiple species
    107521783 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107521783 (AKT2)
   05205 Proteoglycans in cancer
    107521783 (AKT2)
   05230 Central carbon metabolism in cancer
    107521783 (AKT2)
   05231 Choline metabolism in cancer
    107521783 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107521783 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107521783 (AKT2)
   05212 Pancreatic cancer
    107521783 (AKT2)
   05225 Hepatocellular carcinoma
    107521783 (AKT2)
   05226 Gastric cancer
    107521783 (AKT2)
   05214 Glioma
    107521783 (AKT2)
   05221 Acute myeloid leukemia
    107521783 (AKT2)
   05220 Chronic myeloid leukemia
    107521783 (AKT2)
   05218 Melanoma
    107521783 (AKT2)
   05211 Renal cell carcinoma
    107521783 (AKT2)
   05215 Prostate cancer
    107521783 (AKT2)
   05213 Endometrial cancer
    107521783 (AKT2)
   05224 Breast cancer
    107521783 (AKT2)
   05222 Small cell lung cancer
    107521783 (AKT2)
   05223 Non-small cell lung cancer
    107521783 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107521783 (AKT2)
   05017 Spinocerebellar ataxia
    107521783 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107521783 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107521783 (AKT2)
   04931 Insulin resistance
    107521783 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107521783 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107521783 (AKT2)
   05135 Yersinia infection
    107521783 (AKT2)
   05152 Tuberculosis
    107521783 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107521783 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    107521783 (AKT2)
   05161 Hepatitis B
    107521783 (AKT2)
   05160 Hepatitis C
    107521783 (AKT2)
   05164 Influenza A
    107521783 (AKT2)
   05162 Measles
    107521783 (AKT2)
   05168 Herpes simplex virus 1 infection
    107521783 (AKT2)
   05163 Human cytomegalovirus infection
    107521783 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107521783 (AKT2)
   05169 Epstein-Barr virus infection
    107521783 (AKT2)
   05165 Human papillomavirus infection
    107521783 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107521783 (AKT2)
   05142 Chagas disease
    107521783 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107521783 (AKT2)
   01524 Platinum drug resistance
    107521783 (AKT2)
   01522 Endocrine resistance
    107521783 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107521783 (AKT2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107521783 (AKT2)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   107521783 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 107521783
NCBI-ProteinID: XP_016022270
LinkDB
Position
Unknown
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
DYKCGSPSDCSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYNQDHERLFE
LILMEEIRFPRTLGPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLDMDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggcttcacaagcgtggtgaatacatcaag
acctggaggccgcggtatttccttctgaagagtgatggctccttcattggctataaggaa
cggcccgaagcccccgaccagaccctgccccccctaaacaacttctccgttgcagaatgc
cagctgatgaagaccgaaagaccgcggcccaatacctttgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccacgtggactctccagatgagagggaggagtggatg
cgagccatccagatggtggccaacagcctcaagcagcggggcccgggtgaggaccccatg
gactacaagtgtggctcccctagtgactgttcggcggccgaggagatggaagtggcagtt
agcaaggcacgggccaaggtgaccatgaatgacttcgactatctcaaactccttggcaaa
ggcacctttggcaaagtcatcctggtgcgggagaaggccagtggccgctactatgccatg
aagatcctgcggaaggaggtcatcatcgctaaggatgaagtcgcccacacggtcaccgag
agccgggtcctccagaataccagacacccattcctcactgcgctgaagtacgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgccaatggcggcgagctgttcttccac
ctgtcccgggagcgtgtcttcacggaggagcgggcccgcttctacggcgcagagatcgtc
tcagccctggagtacctgcactcgcgggacgtggtttaccgtgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgactttggcctatgcaaagagggc
atcagtgacggagccaccatgaaaaccttctgcgggaccccggaatacctggcacctgag
gtgctggaggacaacgactacggccgggcggtggactggtgggggctgggcgtggtcatg
tacgagatgctgtgcggccgcctgcctttctacaaccaggaccacgagcgcctgttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcggccccgaggccaagtccctg
cttgctgggctgctcaagaaggacccaaagcagaggctcggcggggggcctagcgatgcc
aaggaggtgatggagcacaggttcttcctcagcatcaactggcaggatgtagttcagaaa
aagctcctgccacccttcaaacctcaggtcacgtctgaggttgacacaaggtacttcgat
gacgagttcaccgcccagtccatcacaatcacacccccggaccgctatgacagcctgggc
tcgctcgacatggaccagcggacccacttcccccagttctcctactcggccagcatccgc
gagtga

DBGET integrated database retrieval system