KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498439
Entry
107498439         CDS       T06036                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04141  Protein processing in endoplasmic reticulum
ray04151  PI3K-Akt signaling pathway
ray04211  Longevity regulating pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04668  TNF signaling pathway
ray04728  Dopaminergic synapse
ray04911  Insulin secretion
ray04915  Estrogen signaling pathway
ray04918  Thyroid hormone synthesis
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray05020  Prion disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107498439 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107498439 (ATF6B)
   04022 cGMP-PKG signaling pathway
    107498439 (ATF6B)
   04151 PI3K-Akt signaling pathway
    107498439 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107498439 (ATF6B)
   04915 Estrogen signaling pathway
    107498439 (ATF6B)
   04926 Relaxin signaling pathway
    107498439 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    107498439 (ATF6B)
   04918 Thyroid hormone synthesis
    107498439 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    107498439 (ATF6B)
   04925 Aldosterone synthesis and secretion
    107498439 (ATF6B)
   04927 Cortisol synthesis and secretion
    107498439 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107498439 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107498439 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    107498439 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107498439 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    107498439 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    107498439 (ATF6B)
   05031 Amphetamine addiction
    107498439 (ATF6B)
   05034 Alcoholism
    107498439 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107498439 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498439 (ATF6B)
   05161 Hepatitis B
    107498439 (ATF6B)
   05163 Human cytomegalovirus infection
    107498439 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107498439 (ATF6B)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107498439 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB bZIP_Maf GIT_CC YabA Docking DUF4407
Other DBs
NCBI-GeneID: 107498439
NCBI-ProteinID: XP_015977037
LinkDB
Position
Unknown
AA seq 701 aa
MAELMLLSEIADPTRFFTDNLLNPEDWGPRNCTLYTGLDEVAEEQTQLFRCQEQDVPFGS
SMLDVGMDVSLPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPSSQASGVGE
VLVVKIESLTPPLCLLGDDSTSPFETIHVNVSPTSDNSSDVHTKIEPVSPSSSINSEASL
LSAESPNQDFIGEILEVKTESPSPQECLLQDVPGPPPGAFQISMSPSLDGSSGKTLPTRK
PPLQPKPVVITTVPVPPRAMPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGPPPPAPR
PERKSIVPAPMPGNSCPPEVDTKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVL
ADNQQLRRENAALRRRLEVLLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPL
APVSPGMSREAPRPRRHLLEFSAQLPVHGVETLEGSQGPEESQPSPEGQPGFRNLTAFTR
GAKELLLRDLDQLFLSSDCRHVNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQL
QKTSPPVKAVPTQPPGPLERDSVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRDHL
LLPAISHNKTSRPKMSLVMPAMAPNETVSGRGAPGDYEEMMQIECEVMDTRVIHIKTSTV
PPSLRKQPSSTPGNATGGPLPASAAGQAPQATHQPLYLNHP
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggcggagctcatgctcctcagcgagattgcggacccgacgcgtttttttacagacaac
ttgctgaacccggaggactggggtccgcggaactgcaccttgtataccggcctggatgaa
gtggctgaggagcagacgcagctctttcgttgtcaggagcaggatgtcccgtttggcagc
agcatgctggatgtggggatggatgtcagcctccctgaacccccatgggaccccctgcct
atcttcccagatcttcaggtgaagtctgagccatcctctccttgctcttcctcttctctc
agctcagaatcatcacatctttccacagagccctccagccaggcctctggtgtaggggag
gtgctggttgtgaagatagagtccttgacacctccactctgcctcctgggagatgattca
acatccccatttgaaaccatccatgtcaatgtgagccccacctctgataattcctcagat
gtccataccaagatagaacctgtctctccatcttcctccatcaactctgaggcttccctg
ctctcagcagagtctcccaaccaggattttataggagagatactggaagtgaagacagag
tctccatcccctcaagagtgtctcctgcaggatgtcccaggccccccacctggagctttc
cagattagcatgagtccatccctcgatggatcctcaggcaaaaccctgcccacccggaag
ccaccattgcagcccaaacctgtggtgataaccactgtcccagtgccacccagagctatg
cctcccagcaccaccgtccttttgcagccccttgtccagccacccccagtgtccccagtt
gtcctcatccaaggtgctattcgagtccagcctgaagggccgcccccacctgctccacgg
cctgaaaggaagagcattgttccagctcctatgcctgggaactcctgccctcctgaagtg
gatacaaagctgctgaagcggcagcagcgaatgatcaagaaccgggagtccgcttgccag
tcccggaggaagaagaaagagtacctgcagggtctggaagctcggctgcaggcggtgctg
gcagacaaccagcagctgcgccgggagaatgctgccctccggcggcgactggaggtcctg
ctggctgagaacagtgagctcaagttagggtctggaaacaggaaggtggtctgcatcatg
gtcttcctgctcttcatcgccttcaacttcgggcctgtcagcatcagtgagccaccgttg
gctcctgtctctcctgggatgagcagagaggcgcctcgacctcggagacacttgctggaa
ttctcagcacaattgccggttcatggggttgagacccttgagggctcccagggccctgag
gagtcccagcccagccccgaaggccagccaggtttcaggaacctgacagccttcaccagg
ggtgccaaggaactgctgctaagagacctggaccagctcttcctctcctctgactgccgg
catgtcaaccgaactgagtccttgaggcttgctgacgagctgagtggctgggtgcagcgc
caccagagaggccggcggaagatcccccagagggcccaggagagacagaagtctcagcta
cagaagacatcgcctccagttaaggcagtccccacccaaccccctgggcccttagaaagg
gattctgtaggacagctgcagctgtatcgccacccagaccgttcacagccagagttcctg
gatgcaattgaccgacgggaagacacattttatgttgtctccttccgacgggaccacttg
ctgctcccagccatcagccacaacaagacctctcggcctaagatgtccctggtgatgcct
gccatggcccccaatgagacagtatcaggccggggggcccctggggactatgaggagatg
atgcagatcgagtgtgaggtcatggacaccagagtgattcacatcaagacctccacagtg
cccccttcactccgaaaacagccgtcctcgaccccaggcaatgccacaggtggccccttg
ccagcttctgcagctggccaggccccccaggccacccatcagcctctctacctcaatcat
ccctga

DBGET integrated database retrieval system