KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498449
Entry
107498449         CDS       T06036                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-15 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107498449
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107498449
   04145 Phagosome
    107498449
  09143 Cell growth and death
   04218 Cellular senescence
    107498449
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107498449
   04612 Antigen processing and presentation
    107498449
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107498449
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107498449
   05330 Allograft rejection
    107498449
   05332 Graft-versus-host disease
    107498449
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107498449
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107498449
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498449
   05170 Human immunodeficiency virus 1 infection
    107498449
   05168 Herpes simplex virus 1 infection
    107498449
   05163 Human cytomegalovirus infection
    107498449
   05167 Kaposi sarcoma-associated herpesvirus infection
    107498449
   05169 Epstein-Barr virus infection
    107498449
   05165 Human papillomavirus infection
    107498449
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107498449
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107498449
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107498449
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107498449
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig MATalpha_HMGbox Ig_2
Other DBs
NCBI-GeneID: 107498449
NCBI-ProteinID: XP_015977053
LinkDB
Position
Unknown
AA seq 332 aa
MRVMGPRTLLLLLLGALAMTETWAGSHSLSDAANPREEPRAPWMEQEDLLYWDQQTRTCR
DTAQSYRVSLDKVRGYYNQSQAGSHTLQSMYGCDVGPDGRLLRGYGQFAYDGADYIALNE
DLRSWTAADVAAQITRHRWEEAGDTERWRAYLEGMCVEWLLRYLEQGKETLQRADPPKTH
VTHHPISDHEVTLRCWALGFYPEEITLTWQRDGEDQTQDMELVETRPAGDGTFQKWAAVV
VPSGEEQRYTCHVQHEGLPQPLTLRWEPPPGTIPIVGVIAALVLLGTVVIGAVVGAVMWR
RKCSGGKGGIYIQAANSDSAQGSDVSLMASKA
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcgggtcatggggccccgaaccctcctcctgctgctcttgggggccctggccatgacc
gagacctgggcgggttcccactccctgagcgacgccgcgaatccgagggaggagccgcgg
gcgccgtggatggagcaggaggatctgctgtactgggaccagcagacacggacctgccga
gacaccgcacagagttaccgagtgagcctggacaaagtgcgcggctactacaaccagagc
caggccgggtctcacaccttgcagagcatgtacggctgcgacgtggggccggacgggcgc
ctcctccgcgggtacggtcagttcgcctacgacggcgccgattacatcgcgctgaacgag
gacctgcgctcctggaccgcggccgacgtggcggctcagatcacccggcacaggtgggag
gaggccggtgacacggagcgctggagggcctacctggagggcatgtgcgtggagtggctc
ctcagatacctggagcagggcaaggagacgctgcagcgcgcagaccctccaaagacacac
gtgacccaccaccccatctctgaccatgaggtcaccctgaggtgctgggccttgggcttc
taccctgaggagatcaccctgacctggcagcgtgacggggaggaccagacccaggacatg
gagctcgtggagaccaggcctgcaggggacgggaccttccagaagtgggcagcagtggtg
gtgccttctggagaggagcagagatacacgtgccacgtgcagcacgaggggctgccccag
cccctcaccctgagatgggagcctcctccaggcaccatccccattgtgggtgtcattgct
gccctggtcctccttggaactgtggtcattggagctgtggttggagctgtgatgtggagg
aggaagtgctcaggtggaaaaggagggatctacattcaggctgcaaacagtgatagtgcc
cagggctctgatgtttctctcatggcttctaaagcatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503252
Entry
107503252         CDS       T06036                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-48 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107503252
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107503252
   04145 Phagosome
    107503252
  09143 Cell growth and death
   04218 Cellular senescence
    107503252
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107503252
   04612 Antigen processing and presentation
    107503252
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107503252
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107503252
   05330 Allograft rejection
    107503252
   05332 Graft-versus-host disease
    107503252
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107503252
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107503252
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107503252
   05170 Human immunodeficiency virus 1 infection
    107503252
   05168 Herpes simplex virus 1 infection
    107503252
   05163 Human cytomegalovirus infection
    107503252
   05167 Kaposi sarcoma-associated herpesvirus infection
    107503252
   05169 Epstein-Barr virus infection
    107503252
   05165 Human papillomavirus infection
    107503252
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107503252
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107503252
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107503252
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107503252
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_C ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 107503252
NCBI-ProteinID: XP_015986715
LinkDB
Position
Unknown
AA seq 408 aa
MGPRTLLLLLSGALALTETWARLHSLRYFYTAWSRPGHGEPRFVTVGYVDDTQFSRFDSD
AASPREEPRAPWMEQVAQEDPRYWDQETQRSRDSAQTMRVNLRTLRRYYNQSEAGSHTLQ
GMHGCDVGPDGRLLRGYHQYAYDGADYLALNEDLHSWTAADTAAQITRRKLEEARVAEIR
RAYLERPCVQWLRRYLEMGKETLQRADPPKAHVTHHPISDNAVTLRCWALGFYPEEITLT
WQRDGEDQTQDMELVETRPAGDGTFQKWAAVAVPSGEEQRYTCHVQHEGLPQPLTLRWGS
SPSVPFLEPPPPATLVFMFMFAFLVVLVVAVFGAAMWRRKHSGGEGVGSEFSCPTVGLRA
PGGIGGIYVRAANSGSARGCHVSLKAPGGLTGEKLWKKPQAGCLLGSA
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggggccccgaaccctcctgctgctgctctcgggggccctggccctgaccgagacctgg
gcgcgtttgcactccctgaggtatttctacaccgcctggtcgcggcccgggcacggggag
ccccgcttcgtcaccgtcggctacgtggacgacacgcagttctcgcggttcgacagcgac
gccgcgagtcccagggaggagccgcgggcaccgtggatggagcaggtggcgcaggaggat
ccgcggtactgggaccaggagactcagagatcacgtgactcagcacagactatgcgagtg
aacctgagaaccctgcgccgctactacaaccagagcgaggccgggtctcacaccctccag
ggcatgcacggctgcgacgtggggccggacgggcgcctcctccgcgggtaccatcagtac
gcctacgacggcgccgattacctcgcgctgaacgaggacctgcactcctggaccgcggcc
gacacagcggcccagatcacccggcgcaagctggaggaggccagggtggcggagatccgg
agggcctacctggagcgcccgtgcgtgcagtggctccgcagatacctggagatgggcaag
gagacgctgcagcgcgcagaccctccaaaggcacacgtgacccaccaccccatctctgac
aatgcggtcaccctgcggtgctgggccctgggcttctaccccgaggagatcaccctgacc
tggcagcgtgacggggaggaccagacccaggacatggagctcgtggagaccaggcccgca
ggggacgggaccttccagaagtgggcggcagtggcggtgccttctggagaggagcagaga
tacacgtgccacgtgcagcacgaggggctaccgcagcccctcaccctgagatgggggtcc
tcaccgtctgttcccttcctagagccacctcctccggccacccttgtctttatgttcatg
tttgctttcctggtcgtccttgtggtcgctgtgtttggagctgcgatgtggaggaggaag
cactcaggtggggaaggagtggggtccgagttctcttgtcccactgtcgggcttcgagcc
ccaggtggaataggagggatctacgttcgggctgcaaacagtggtagtgcccgaggctgt
catgtgtctctcaaggccccgggtggcctaactggtgagaagctgtggaagaagccacag
gccggctgccttctggggagcgcgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505290
Entry
107505290         CDS       T06036                                 

Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107505290
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107505290
   04145 Phagosome
    107505290
  09143 Cell growth and death
   04218 Cellular senescence
    107505290
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107505290
   04612 Antigen processing and presentation
    107505290
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107505290
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107505290
   05330 Allograft rejection
    107505290
   05332 Graft-versus-host disease
    107505290
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107505290
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107505290
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107505290
   05170 Human immunodeficiency virus 1 infection
    107505290
   05168 Herpes simplex virus 1 infection
    107505290
   05163 Human cytomegalovirus infection
    107505290
   05167 Kaposi sarcoma-associated herpesvirus infection
    107505290
   05169 Epstein-Barr virus infection
    107505290
   05165 Human papillomavirus infection
    107505290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107505290
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107505290
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107505290
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107505290
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_C C2-set_2 ig MHC_I_3 Ig_2
Other DBs
NCBI-GeneID: 107505290
NCBI-ProteinID: XP_015990795
LinkDB
Position
Unknown
AA seq 356 aa
MPVMGPRPLLLLLSGALALTKTWAGSHSLRYFHTTWSRPGSGEPRFVSVGYVDDTQFARL
DSDAASPREVLWAPWMERMVQEDPQYRDQETRYFQGTAQYFRGSLNDVRGHYNQSEAGSH
TIQALCRCDVGPDGRLLRGYHQLAYDGADYIALNEDLRSWTAAAGAAQITRRKWEEAGET
ELIRAYLEGTCVERLLRYLEKGKETLRRADPPKTCVTHHPISDHEVTLRCWALGFYPAEI
TLTWQRDGEDQTQDMELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLTLR
WEPPPGTIPIVGVIAALVLLGVVVTGAVVGAVMWRKKRSDSDSAQGSDMSLTASKA
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgccagtcatggggccccgacccctcctcctgctgctctcgggggccctggccctgacc
aagacctgggcgggttcccactccctgaggtatttccacaccacctggtcccggcccggg
agcggggagccccgcttcgtttccgtcggctacgtggacgacacgcagttcgcgcggtta
gacagcgacgccgcgagtccgagggaggtgctgtgggcgccgtggatggagcggatggtg
caggaggatccgcagtatcgggaccaggagacacggtacttccagggcaccgcacagtat
ttccgagggagcctgaacgacgtgcgcggccactacaaccagagcgaggccgggtctcac
accatccaggccctatgccgctgcgacgtggggccggacgggcgcctcctccgcgggtac
catcagctcgcctacgacggcgccgattacatcgcgctgaacgaggacctgcgctcctgg
accgcggcggcgggggcggctcagatcacccggcgcaagtgggaggaggccggtgagacg
gagctcatcagggcctacctggagggcacgtgcgtggagcggctcctcagatacctggag
aaaggcaaggagacgctgcggcgcgcagaccctccaaaaacatgcgtgacccaccacccc
atttctgaccatgaggtcaccctgaggtgctgggccctgggcttctaccctgcggagatc
accctgacctggcagcgtgacggggaggaccagacccaggacatggagctcgtggagacc
aggcctgcaggggacgggaccttccagaagtgggcggcagtggtggtgccttctggagag
gagcagagatacacgtgccacgtgcagcacgaggggctgccccagcccctcaccctgaga
tgggagcctcctccaggcaccatccccattgtgggtgtcattgctgccctggtcctcctt
ggagttgtggtcactggagctgtggttggagctgtgatgtggaggaagaagcgctcagac
agcgacagcgcccagggctctgatatgtctctcacggcttctaaagcatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506218
Entry
107506218         CDS       T06036                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-14 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107506218
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107506218
   04145 Phagosome
    107506218
  09143 Cell growth and death
   04218 Cellular senescence
    107506218
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107506218
   04612 Antigen processing and presentation
    107506218
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107506218
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107506218
   05330 Allograft rejection
    107506218
   05332 Graft-versus-host disease
    107506218
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107506218
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107506218
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107506218
   05170 Human immunodeficiency virus 1 infection
    107506218
   05168 Herpes simplex virus 1 infection
    107506218
   05163 Human cytomegalovirus infection
    107506218
   05167 Kaposi sarcoma-associated herpesvirus infection
    107506218
   05169 Epstein-Barr virus infection
    107506218
   05165 Human papillomavirus infection
    107506218
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107506218
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107506218
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107506218
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107506218
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 107506218
NCBI-ProteinID: XP_015992346
LinkDB
Position
Unknown
AA seq 384 aa
MRVMGPRTLLLLLSGALALTETWAGSHSLRYFYTAWSRPGSGEPRFVSVAYVDDTQLARF
DSDTANPRLEPQAPWMEQVEQEDPQYRDRSTRICRDTAQAFRVDLKTLRGYYNQSEAGSH
TYQQMYGCDVGPDGRLLRGYNQFAYDGADHIALNEDLRSWTAAEGAAQNIQRKWEEAGVA
QRWRAYLEGECVKRLLRHLEKGKETLQRADPPKTHVTHHPISDGEVTLRCWALGFYPAEI
TLTWQRDGEDQTQDMELVETRPAGDGTFQKWAAVMVPSGEEQRYTCHVQHEGLPQPLTLR
WEPPPPATIPIVGVIAALVLLGVVVTGTVAGVVMWKRKRSGGKGGIYVQAATTSPMSSDH
ILFCPTPDSDSAQGSDVSLTASKA
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgcgggtcatggggccccgaaccctcctcctgctgctctcgggggccctggccctgacc
gagacctgggcgggctcccactccctgaggtatttctacactgcctggtcccggcccggg
agcggggagccccgcttcgtttccgtcgcctacgtggacgacacgcagttggctcggttc
gacagcgacaccgcgaatccgaggttggagccgcaggcgccgtggatggagcaggtggag
caggaggatccacagtatcgggaccggagcacccggatctgccgggacacagcgcaggct
ttccgagtggacctgaaaaccctgcgcggctactacaaccagagcgaggccgggtctcac
acgtaccagcagatgtacggctgcgacgtggggccggacgggcgcctcctccgcgggtac
aatcagttcgcctacgacggcgccgatcacatcgcgctgaacgaggatctgcgctcctgg
accgcggccgagggggcggctcagaatatccagcgcaagtgggaggaggcaggtgtggcg
cagcgctggagggcctacctggagggggagtgcgtgaagcggctcctcagacacctggag
aagggcaaggagacgctgcagcgcgcagaccctccaaaaacacacgtgacccaccacccc
atctctgatggtgaggtcaccctgaggtgctgggccctgggcttctaccctgcggagatc
accctgacctggcagcgtgacggggaggaccagacccaggacatggagctcgtggagacc
aggcctgcaggggacgggaccttccagaagtgggcggcagtgatggtgccttctggagag
gagcagagatacacgtgccatgtgcagcacgaggggctgccccagcccctcaccctgaga
tgggagccaccacctccggccaccatccccattgtgggtgtcattgctgccctggtcctc
cttggagttgtggtcactggaactgtggctggagttgtgatgtggaagaggaagcgctca
ggtggaaaaggagggatctatgttcaggctgcaaccacatctcctatgagctctgaccac
atcctgttttgtcctaccccagacagcgacagcgcccagggctctgatgtgtctctcaca
gcttctaaagcatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506412
Entry
107506412         CDS       T06036                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-30 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107506412
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107506412
   04145 Phagosome
    107506412
  09143 Cell growth and death
   04218 Cellular senescence
    107506412
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107506412
   04612 Antigen processing and presentation
    107506412
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107506412
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107506412
   05330 Allograft rejection
    107506412
   05332 Graft-versus-host disease
    107506412
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107506412
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107506412
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107506412
   05170 Human immunodeficiency virus 1 infection
    107506412
   05168 Herpes simplex virus 1 infection
    107506412
   05163 Human cytomegalovirus infection
    107506412
   05167 Kaposi sarcoma-associated herpesvirus infection
    107506412
   05169 Epstein-Barr virus infection
    107506412
   05165 Human papillomavirus infection
    107506412
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107506412
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107506412
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107506412
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107506412
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 LapA_dom ig Ig_2
Other DBs
NCBI-GeneID: 107506412
NCBI-ProteinID: XP_015992571
LinkDB
Position
Unknown
AA seq 357 aa
MRVMGPRPLLLLLSGALALTETWAGSHSLRYFRTALFRPGSGEPRFVPVGYVDDTQFARF
DSDAASPRMELWAPWMERMVQEDPQYWDQETRNFQGHAQYFRLSLDNVRGNYNQSEAESH
TLQVICGCDVGSDGRLLRGYGQFAYDGADYIALNEDLRSLTAAHVEAQITRHKWEEAGLA
QRWRAYLEGECVERLLKYLERGKETLQRADPPKTHVTHHPISDREVTLKCWALGFYPAEI
TLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLTLR
WEPPSLATIPIVVIIAALVLLGAAVTGAVVGAVMWRRKRSDSDSAQGSDVSLMASKA
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgcgggtcatggggccccgacctctcctcctgctgctctcgggagccctggccctgacc
gagacctgggcgggttcccactccctgaggtatttccgcaccgccttgttccggcccggg
agcggggagccccgcttcgttcctgtcggctacgtggacgacacgcagttcgcgcggttc
gacagcgacgccgcgagtccgaggatggagctgtgggcgccgtggatggagcggatggtg
caggaggatccgcagtactgggaccaggagacacggaacttccagggccacgcacagtat
ttccgattgagtctggacaacgtgcgcggcaactacaaccagagcgaggccgagtctcac
accctccaggtcatctgcggctgcgacgtggggtcggacgggcgcctcctccgcgggtac
ggtcagttcgcctacgacggcgccgattacatcgcgctgaacgaggacctgcgctctttg
acggcggcccacgtggaggctcagatcacccggcacaagtgggaggaggccggtttggcg
cagcgctggagggcctacctggagggggagtgcgtggagcggctcctcaaatacctggag
aggggcaaggagacgctgcagcgcgcagaccctccaaagacacacgtgacccaccacccc
atctctgaccgtgaggtcaccctgaagtgctgggccctgggcttctaccctgcggagatc
accctgacctggcagcgtgacggggaggaccagacccaggacacggagctcgtggagacc
aggcccgcaggagacgggaccttccagaagtgggcggcagtggtggtgccttctggagag
gagcagagatacacgtgccacgtgcagcacgaggggctgccccagcccctcaccctgaga
tgggagcctccttctctggccaccatccccattgtggtcatcatagctgccctggtcctc
cttggagctgcggtcactggagctgtggtcggagctgtgatgtggaggaggaagcgctca
gacagtgacagtgcccagggctctgatgtgtctctcatggcttctaaagcatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506470
Entry
107506470         CDS       T06036                                 

Definition
(RefSeq) patr class I histocompatibility antigen, B-2 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107506470
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107506470
   04145 Phagosome
    107506470
  09143 Cell growth and death
   04218 Cellular senescence
    107506470
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107506470
   04612 Antigen processing and presentation
    107506470
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107506470
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107506470
   05330 Allograft rejection
    107506470
   05332 Graft-versus-host disease
    107506470
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107506470
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107506470
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107506470
   05170 Human immunodeficiency virus 1 infection
    107506470
   05168 Herpes simplex virus 1 infection
    107506470
   05163 Human cytomegalovirus infection
    107506470
   05167 Kaposi sarcoma-associated herpesvirus infection
    107506470
   05169 Epstein-Barr virus infection
    107506470
   05165 Human papillomavirus infection
    107506470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107506470
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107506470
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107506470
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107506470
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig MATalpha_HMGbox Ig_2
Other DBs
NCBI-GeneID: 107506470
NCBI-ProteinID: XP_015992643
LinkDB
Position
Unknown
AA seq 401 aa
MRVMGPRPLLLLLSGALALTETWAGFHSLRYFRTAWSRPGSREPRFVSVGYVDDTQFVRF
DSDAASPRAEPRAPWMEQVELEDPQYWDRETRNFQDTAQNYRVSLKTLRGYYNQSEAGSH
IIQGMHGCDVGPDGRLLRGYGQYAYDGADYIALNEDLRSWTAADVAAQNLPGKLGGGRWA
ERRRAYLKGECVTWLLKHLEMGKETLQRADPPKTHVTHHPISDREVTLRCWALGFYPAEI
TLTWQRDGEDQTQDMELVETRPAGDGTFQKWVAVVVPSGEEQRYTCHVQHEGLPQPLTLR
WERPPPATMSIVGVLAALVLLGVVVTGAVVRAVMWRRKRSGGRGEIYVQAANSDSAQGSD
VSLTASKDETLGGLKWRGAGAEGTGLGNVHSLGSFEHMVEY
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgcgggtcatggggccccgacctctcctcctgctgctctcgggagccctggccctgacc
gagacctgggcgggtttccactccctgaggtatttccgcaccgcctggtcccggcccggg
agcagggagccccgcttcgtttccgtcggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagtccgagggcggagccgcgggcgccgtggatggagcaggtggag
ctggaggatccgcagtactgggaccgcgagacacggaacttccaggacaccgcacagaat
taccgagtgagcctgaaaaccctgcgcggctactacaaccagagcgaggccgggtctcac
atcatccagggcatgcacggctgcgacgtggggccggacgggcgcctcctccgcgggtac
ggtcaatacgcctacgacggcgccgattacatcgcgctgaacgaggacctgcgctcctgg
accgcggccgacgtggcggctcagaatttacccggcaagctgggaggaggcaggtgggcg
gagcgccggagggcctacctgaagggggagtgcgtgacgtggctcctcaaacatctagag
atgggcaaggagacgcttcagcgcgcagaccctccaaagactcacgtgacccaccacccc
atctctgaccgtgaggtcaccctgaggtgctgggccctgggcttctaccctgcggagatc
accctgacctggcagcgtgacggggaggaccagacccaggacatggagctcgtggagacc
aggcctgcaggggatggaaccttccagaagtgggtggcagtggtggtgccttctggagag
gagcagagatacacgtgccatgtgcagcacgaggggctgccccagcccctcaccctgaga
tgggagcgaccacctccagccaccatgtccattgtgggtgtccttgctgccctggtcctc
cttggagttgtggtcactggagctgtggtcagagctgtgatgtggaggaggaagcgctca
ggtggaagaggagaaatctacgttcaggctgcaaacagtgacagtgcccagggctctgat
gtgtctctcacggcttctaaagatgagaccctgggtggcctaaagtggcgaggggctggg
gcagaggggacaggcctgggtaatgtgcattctttgggatcttttgagcatatggtggag
tattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506555
Entry
107506555         CDS       T06036                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-126 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107506555
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107506555
   04145 Phagosome
    107506555
  09143 Cell growth and death
   04218 Cellular senescence
    107506555
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107506555
   04612 Antigen processing and presentation
    107506555
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107506555
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107506555
   05330 Allograft rejection
    107506555
   05332 Graft-versus-host disease
    107506555
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107506555
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107506555
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107506555
   05170 Human immunodeficiency virus 1 infection
    107506555
   05168 Herpes simplex virus 1 infection
    107506555
   05163 Human cytomegalovirus infection
    107506555
   05167 Kaposi sarcoma-associated herpesvirus infection
    107506555
   05169 Epstein-Barr virus infection
    107506555
   05165 Human papillomavirus infection
    107506555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107506555
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107506555
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107506555
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107506555
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 MHC_I_C EF-hand_13 ig
Other DBs
NCBI-GeneID: 107506555
NCBI-ProteinID: XP_015992751
LinkDB
Position
Unknown
AA seq 397 aa
MTGPQFSLPLRVGFLEKSISHRLFIRFPRPRQDAGSLQTPRMRVVGPRTLLLLLSGSLAL
TETWAGFHSLKYFHTAWFQPESGEPRFLTVGYVDDMQFARLGSGAASLEKVLWAPWMERM
VQEDPQYRDQETRYFQVHAQYFQGNIQTIFHYYNQSEAGSHTIQALCGCDVGSDGRLLRG
YGRLAYDGADYIALNEDLRSWTAAEGAAQITRHKWEEAGVAERWRAFMEVTCLKRLLKYL
EKGKETLQRADPPKTHMTHHHITDREVTLRCWALGFYPAEITLTWQRDGEDQTQDMELME
TRPAGDGTFQKWAAVVVPSGEEQRYMCHVQHEGLPQPLTLRWEPPPATIPIVVVLAALVL
LGVVVTGAVVGAVMWRRKCSDSDSTQNSDVSLTNFKA
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgacgggaccccagttctcactcccattgcgcgtcgggtttctagagaagtcaattagt
caccgcctgtttataaggtttccacggccccgccaggatgcaggttctctccagactccg
aggatgcgggtcgtggggccccgaaccctcctcctgctgctctcggggtccctggccctg
accgagacctgggcgggtttccactccttgaagtatttccacaccgcctggttccagccc
gagagcggggagccccgcttcctcaccgtcggctacgtggacgacatgcagttcgcgcgg
ttaggcagcggcgccgcgagtctagagaaggtgctgtgggcgccgtggatggagcggatg
gtgcaggaggatccgcagtatcgggaccaggagacacggtacttccaggtccacgcacag
tatttccaagggaacatacagactatattccactactacaaccagagcgaggctgggtct
cacaccatccaggccctatgcggctgcgacgtggggtcggacgggcgcctcctccgcggg
tacggtcggctcgcctacgacggcgccgattacatcgcgctgaacgaggacctgcgctcc
tggaccgcggccgagggggcggctcagatcacccggcacaagtgggaggaggcaggtgtg
gcggagcgctggagggccttcatggaggtcacgtgcttgaagcggctcctcaaatacctg
gagaagggcaaggagacgctgcagcgagcagaccctccaaagacacacatgacccaccac
cacatcactgaccgtgaggtcaccctgaggtgctgggctctgggcttctaccctgcggag
atcacactgacctggcagcgtgatggggaggaccagactcaggacatggagctcatggag
accaggcctgcaggggatggaaccttccagaagtgggcggcagtggtggtgccttctgga
gaggagcagagatacatgtgccacgtgcagcatgaggggctgccccagcccctcaccctg
agatgggagccgcctccagccaccatccccattgtggttgtccttgctgccctggtcctc
cttggagttgtggtcactggagctgtggtgggagctgtgatgtggaggaggaagtgctca
gacagtgacagtacccagaactctgatgtgtctctcacgaattttaaagcatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507129
Entry
107507129         CDS       T06036                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-14 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107507129
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107507129
   04145 Phagosome
    107507129
  09143 Cell growth and death
   04218 Cellular senescence
    107507129
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107507129
   04612 Antigen processing and presentation
    107507129
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107507129
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107507129
   05330 Allograft rejection
    107507129
   05332 Graft-versus-host disease
    107507129
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107507129
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107507129
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107507129
   05170 Human immunodeficiency virus 1 infection
    107507129
   05168 Herpes simplex virus 1 infection
    107507129
   05163 Human cytomegalovirus infection
    107507129
   05167 Kaposi sarcoma-associated herpesvirus infection
    107507129
   05169 Epstein-Barr virus infection
    107507129
   05165 Human papillomavirus infection
    107507129
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107507129
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107507129
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107507129
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107507129
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Psg1 Ig_2 MATalpha_HMGbox
Other DBs
NCBI-GeneID: 107507129
NCBI-ProteinID: XP_015993629
LinkDB
Position
Unknown
AA seq 382 aa
MRVMGPRTLLLLLSGALALPETWAGLHSLRYFQTAWSRPGRGEPRFVAVGYVDDTQFVRF
DSDAASPRMEPRAPWMEQVEREDAQYWERNTRIAQGNAQTFRGNLDNVRGYYNQSEAGSH
TLQWMCGCDVGPDGRLLRGYSQFAYDGADYIALNEDLRSWTAADVAAQITRRKWEEAGDA
EQRRAYLEGTCVEWLLKHLDMGKETLQRADPPKAHVTHHPISDNAVTLRCWALGFYPEEI
TLTWQRDGEDQTQDMELVETRPAGDGTFQKWAAVAVPSGEEQRYTCHVQHEGLPQPLTLR
WEPPPPATIPIVAIIAALVVLGAIGAVVGTVMWWRKRSGGRGAIQVQAATTSPMSSDHIL
FCPTPDSDSAQGSDVSLTASKA
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgcgggtcatggggccccgaaccctcctcctgctgctctcgggggccctggccctgccc
gagacctgggcgggcctccactccctgaggtatttccaaaccgcctggtcccggcccggg
cgcggggagccccgcttcgtcgccgtcggctatgtggacgacacgcagttcgtgcggttc
gacagcgacgcggcgagtccgaggatggagccgcgggcgccgtggatggagcaggtggag
cgggaggatgcgcagtactgggagcggaacacgcggatcgcccagggcaacgcacagact
ttccgagggaacctggacaacgtgcgcggctactacaaccagagcgaggccgggtctcac
accctccagtggatgtgcggctgcgacgtggggccggacgggcgcctcctccgcgggtac
agtcagttcgcctacgacggcgccgattacatcgcgctgaacgaggacctgcgctcctgg
accgcggccgacgtggcggcgcagatcacgcggcgcaagtgggaggaggccggggacgcg
gagcaacggagggcctacctggagggcacgtgcgtggagtggctcctcaaacacctggat
atgggcaaggagacgctgcagcgcgcagaccctccaaaggcacacgtgacccaccacccc
atctctgacaatgcggtcaccctgcggtgctgggccctgggcttctaccctgaggagatc
accctgacctggcagcgtgacggggaggaccagacccaggacatggagctcgtggagacc
aggcccgcaggggacgggaccttccagaagtgggcggcagtggcggtgccttctggagag
gagcagagatacacgtgccacgtgcagcacgaggggctgccgcagcccctcaccctgaga
tgggagcctcctcctccggccaccatccccattgtggcgatcattgctgccctggtcgtc
cttggggccattggagctgtggtgggaactgtgatgtggtggaggaagcgctcaggtgga
agaggagcgatccaagttcaggctgcaaccacatctcctatgagctctgaccacatcctg
ttttgtcctaccccagacagtgacagcgcccagggctctgatgtgtctctcacggcttct
aaagcgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509876
Entry
107509876         CDS       T06036                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-48 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107509876
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107509876
   04145 Phagosome
    107509876
  09143 Cell growth and death
   04218 Cellular senescence
    107509876
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107509876
   04612 Antigen processing and presentation
    107509876
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107509876
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107509876
   05330 Allograft rejection
    107509876
   05332 Graft-versus-host disease
    107509876
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107509876
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107509876
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107509876
   05170 Human immunodeficiency virus 1 infection
    107509876
   05168 Herpes simplex virus 1 infection
    107509876
   05163 Human cytomegalovirus infection
    107509876
   05167 Kaposi sarcoma-associated herpesvirus infection
    107509876
   05169 Epstein-Barr virus infection
    107509876
   05165 Human papillomavirus infection
    107509876
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107509876
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107509876
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107509876
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107509876
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 MHC_I_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 107509876
NCBI-ProteinID: XP_015998259
LinkDB
Position
Unknown
AA seq 370 aa
MGPRTLLLLSGALALTETWARLHSLRYFYTAWSPPGHGELRLVSVGYVDDTQFLRFDSDA
ASPRAEPRAPWMEQVAQQDPQYWDRQTELLSDAAQTMRVNLRTLRRYYNQSEAGSHTIQV
MYGCDVEVGPDGRLLRGYHQYAYDGADYLALNEDLRSWTAADAAAQITRRKLEEAGAAEI
PRAYLEGECVQWLRRYLEMGKETLQRADPPKAHVTHHPISDNAVTLRCWALGFYPEEITL
TWQRDGEDQTQDMELVETRPAGDGTFQKWAAVAVPSGEEQRYTCHVQHEGLLQPLTLRWE
PPPPATIPIVAILPVLILLGVVVIVAMVWRSAMWRRKCSGGKGGIYVQAANSGSAQGCHV
SLKAPGGLTW
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggccccgaaccctcctgctgctctcgggggccctggccctgaccgagacctgggcg
cgtttgcactccctgaggtatttctacaccgcctggtcgccgcccgggcacggcgagctc
cgcttggtctccgtcggctacgtggacgacacgcagttcctgcggttcgacagcgacgcc
gcgagtcccagggcggagccgcgggcgccgtggatggagcaggtggcgcagcaggatccg
cagtactgggaccggcagacggagttattaagtgacgcagcacagactatgcgagtgaac
ctgagaaccctgcgccgctactacaaccagagcgaggccgggtctcacaccatccaggtc
atgtacggctgcgacgtggaagtggggccggacgggcgcctcctccgcgggtaccatcag
tacgcctacgacggcgccgattaccttgcgctgaacgaggacctgcgctcctggaccgcg
gccgacgcggcggcccagatcacccggcgcaagctggaggaggccggggcggcggagatc
ccgagggcctacctggagggggagtgcgtgcagtggctccgcagatacctggagatgggc
aaggagacgctgcagcgcgcagaccctccaaaggcacacgtgacccaccaccccatctct
gacaatgcggtcaccctgcggtgctgggccctgggcttctaccccgaggagatcaccctg
acctggcagcgtgacggggaggaccagacccaggacatggagctggtggagaccaggccc
gcaggggacgggaccttccagaagtgggcagcagtggcggtgccttctggagaggagcag
agatacacgtgccacgtgcagcacgaggggctgctgcagcccctcaccctgagatgggag
ccgcctcctccggccaccatccccattgtggcgatccttcctgtcctgatcctccttgga
gttgtggtcattgttgctatggtgtggagatctgcgatgtggaggaggaagtgctcaggt
ggaaaaggagggatctatgttcaggccgcaaacagtggtagtgcccaaggctgtcatgtg
tctctcaaggccccgggtggcctaacgtggtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511741
Entry
107511741         CDS       T06036                                 

Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107511741
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107511741
   04145 Phagosome
    107511741
  09143 Cell growth and death
   04218 Cellular senescence
    107511741
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107511741
   04612 Antigen processing and presentation
    107511741
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107511741
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107511741
   05330 Allograft rejection
    107511741
   05332 Graft-versus-host disease
    107511741
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107511741
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107511741
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107511741
   05170 Human immunodeficiency virus 1 infection
    107511741
   05168 Herpes simplex virus 1 infection
    107511741
   05163 Human cytomegalovirus infection
    107511741
   05167 Kaposi sarcoma-associated herpesvirus infection
    107511741
   05169 Epstein-Barr virus infection
    107511741
   05165 Human papillomavirus infection
    107511741
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107511741
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107511741
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107511741
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107511741
SSDB
Motif
Pfam: MHC_I
Other DBs
NCBI-GeneID: 107511741
NCBI-ProteinID: XP_016001929
LinkDB
Position
Unknown
AA seq 287 aa
MRVMGPRTLLLLLSGALALPETWAGLHSLRYFSTAWSRPGRGEPRFITVGYVDDTQFVRF
DSDAASPRAEPRAPWMEQMEREDAQYWDEETRRSQGNAQTYRVNLDNVRGYYNQSEAGSH
TIQWMYGCDVGPDGRLLRGYSQFAYDGADYIALNEDLRSWTAADVAAQQKWEEAGAAESW
RAYLEGTCVEWLLRHLDMGKETLQRAGARARGASPLPRGPGLLRGWRKVGPEPPPPLGRD
NESVRVFRSGARGRLAQRAHLPSGTVRGAVSQGTEGETISGITGQRA
NT seq 861 nt   +upstreamnt  +downstreamnt
atgcgggtcatggggccccgaaccctcctcctgctgctctcgggggccctggccctgccc
gagacctgggcgggcctccactccctgaggtatttcagcaccgcctggtcccgccccggg
cgcggggagccccgctttatcaccgtcggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgcggcgagtccgagggcggagccgcgggcgccgtggatggagcagatggag
cgggaggatgcgcagtactgggacgaggagacacggaggtcccagggcaacgcacagact
taccgagtgaacctggacaacgtgcgcggctactacaaccagagcgaggccgggtctcac
accatccagtggatgtacggctgcgacgtggggccggacgggcgcctcctccgcgggtac
agtcagttcgcctacgacggcgccgattacatcgcgctgaacgaggacctgcgctcctgg
accgcggccgacgtggcggctcagcagaagtgggaggaggccggggcggcggagagctgg
agggcctacctggagggcacgtgcgtggagtggctcctcagacacctggacatgggcaag
gagacgctgcagcgcgcaggtgcgagggcccgcggggcctcccctctccctcgggggccg
gggctcctccgaggatggaggaaagtgggacccgagcccccgcctcccctgggccgggac
aatgagtccgtgagggttttcagatccggtgccagagggcggctcgcccagagggcccac
cttccctcaggcacagtgaggggtgctgtctctcagggcacggagggggagaccatctcg
ggaataactggccagcgagcg

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517540
Entry
107517540         CDS       T06036                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107517540
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107517540
   04145 Phagosome
    107517540
  09143 Cell growth and death
   04218 Cellular senescence
    107517540
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107517540
   04612 Antigen processing and presentation
    107517540
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107517540
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107517540
   05330 Allograft rejection
    107517540
   05332 Graft-versus-host disease
    107517540
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107517540
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107517540
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107517540
   05170 Human immunodeficiency virus 1 infection
    107517540
   05168 Herpes simplex virus 1 infection
    107517540
   05163 Human cytomegalovirus infection
    107517540
   05167 Kaposi sarcoma-associated herpesvirus infection
    107517540
   05169 Epstein-Barr virus infection
    107517540
   05165 Human papillomavirus infection
    107517540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107517540
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107517540
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107517540
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107517540
SSDB
Motif
Pfam: MHC_I C1-set
Other DBs
NCBI-GeneID: 107517540
NCBI-ProteinID: XP_016013834
LinkDB
Position
Unknown
AA seq 458 aa
MVAGVDTRPRAPQLKRVSARTSALGQPSRLAARGRRGLWCAPPLLLLLLLELVWESASES
PWGLPVVADGPASLAKVVMAELARLKLENKPWPGGTHSLHYHYLALSEPGPGLPQFLAVG
YVDDHPFIRYDSRVGRAEPQAGWMAPVEAQYWETETQKQRAWAEVQQVETWTVMGYRNHT
GGMHSTQRMFGCTIQEDGRSSSFWQFGFDGQDHLSLDLETLTWVSAEPMAMRTKRWWELE
RCYAEYNKAYVDSLCLTSLRRYLELGGQHLTWKEPPTVYVTRHLTENRGAMLRCWALGFY
PRDISLSWWLGEEELALETEYVETRPSGDGTYQMWAAVQVPAGEEAGYTCHVQHSGLNRT
LTVAWEPPSRHGLIAMVISSILLLLAVGVVILTKRFLQARNKESYKQAPGDCGTDHITDQ
GGVLGVFEGPPCADTEPSAPPSTSLQMVCTTKMASSSS
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggtggcgggcgttgacacaaggccacgggccccacagttgaagagagtctccgccagg
accagcgccctggggcagccatcgaggctggcggccagaggccggcggggcctctggtgc
gcgccgccgcttctgctcctgctgctgttggaactggtgtgggagagcgcgtcagagagt
ccctgggggctgcccgtggtggctgatggcccagcttccttagcaaaggtcgtgatggca
gaactggccagactgaagttagaaaataagccatggcctggagggacgcactccctccac
taccactacctggcgctgtcagagccaggccccggtcttccccagtttctggctgtagga
tacgtggacgaccaccccttcatccggtatgacagccgtgtgggcagggccgagccgcag
gccgggtggatggcgccagtggaagcccagtactgggagacggagacccagaagcagagg
gcctgggcagaggtgcagcaagtggagacgtggacggtgatgggctaccgcaaccacacg
ggcggcatgcatagcactcagcgcatgttcggctgtactatccaggaggatggccgctcc
agcagcttctggcagtttgggtttgatgggcaggaccacctgtcactggacctggagacc
ctgacctgggtatcagctgagcccatggctatgcggactaagcgctggtgggagttggag
cgctgctatgccgagtacaacaaggcctacgtggacagcctctgcctcacttctctgcgc
aggtatctggagctgggaggccagcatctgacctggaaagagccacccacagtgtatgtg
acaaggcacttgaccgagaacaggggtgccatgctgaggtgctgggccctgggtttctac
ccacgggatatctcgctgagttggtggctgggtgaggaagagctggccctggagactgag
tacgtggagacgcgccccagtggggacggcacctaccagatgtgggcggctgtgcaggtg
ccagctggggaggaggccgggtacacctgccatgtgcagcactctggcctgaaccgcaca
ctcactgtggcctgggaaccgccctctcgtcatggactcattgccatggttatctcctct
atcctgctcttgctggcagttggagttgtgattttgaccaaaagattccttcaagcgagg
aataaagagtcttacaagcaagccccaggtgactgtgggacagatcacatcacagatcaa
ggaggtgttctaggagtcttcgagggaccaccctgcgccgatactgagccctccgcaccc
ccgtcgacctcattacaaatggtctgcaccactaagatggcttcctcatcttcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519335
Entry
107519335         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, B-46 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107519335
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107519335
   04145 Phagosome
    107519335
  09143 Cell growth and death
   04218 Cellular senescence
    107519335
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107519335
   04612 Antigen processing and presentation
    107519335
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107519335
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107519335
   05330 Allograft rejection
    107519335
   05332 Graft-versus-host disease
    107519335
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107519335
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107519335
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107519335
   05170 Human immunodeficiency virus 1 infection
    107519335
   05168 Herpes simplex virus 1 infection
    107519335
   05163 Human cytomegalovirus infection
    107519335
   05167 Kaposi sarcoma-associated herpesvirus infection
    107519335
   05169 Epstein-Barr virus infection
    107519335
   05165 Human papillomavirus infection
    107519335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107519335
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107519335
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107519335
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107519335
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Psg1 Ig_2
Other DBs
NCBI-GeneID: 107519335
NCBI-ProteinID: XP_016017363
LinkDB
Position
Unknown
AA seq 366 aa
MRVMGPRTLLLLLSGALALTETWAGLHSLRYFDTAWSRPGRGEPRFVAVGYVDDTQFVRF
DSDAASPRVEPRAPWIEQMERVDAQYWERNTRNAQGDAQTFRVGLDNVRGYYNQSEAGSH
TYQRMYGCDVGPDGRLLRGYXQFAYDGADYIALNEDLRSWTAADVAAQITRRKWEEAGEA
ERWRAYLEGTCVEWLGRYLDMGKETLQRADPPKAHVTHHPISDNEVTLRCWALGFYPEEI
TLTWQRDGEDQTQDMELVETRPAGDGTFQKWAAVAVPSGEEQRYTCHVQHEGLPQPLTLR
WEPPPPATIPIVAIIAALVVLVVTGAVVGTVMWRRKRSGGKGGIYVQAANSDSAQGSDVS
LTASKA
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgcgggtcatggggccccgaactctcctcctgctgctctcgggggccctggccctgacc
gagacctgggcgggcctccactccctgaggtatttcgacaccgcctggtcccggcccggg
cgcggggagccccgcttcgtcgccgtcggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgcggcgagtccgagggtggagccgcgggcgccgtggattgagcagatggag
cgggtggatgcgcagtactgggagcggaacacgcggaacgcccagggcgacgcacagact
ttccgagtgggcctggacaacgtgcgcggctactacaaccagagcgaggccgggtctcac
acctaccagcggatgtacggctgcgacgtggggccggacgggcgcctcctccgcgggtac
natcagttcgcctacgacggcgccgattacatcgcgctgaacgaggacctgcgctcctgg
accgcggccgacgtggcggcgcagatcacgcggcgcaagtgggaggaggccggggaggcg
gagcgctggagggcctacctggagggcacgtgcgtggagtggctcggcagatacctggac
atgggcaaggagacgctgcagcgcgcagaccctccaaaggcacacgtgacccaccacccc
atctctgacaatgaggtcaccctgcggtgctgggccctgggcttctaccctgaggagatc
accctgacctggcagcgtgacggggaggaccagacccaggacatggagctcgtggagacc
aggcccgcaggggacgggaccttccagaagtgggcggcagtggcggtgccttctggagag
gagcagagatacacgtgccacgtgcagcacgaggggctgccgcagcccctcaccctgaga
tgggagcctcctcctccggccaccatccccattgtggcgatcattgctgccctggtcgtc
cttgtggtcactggagctgtggtgggaactgtgatgtggaggaggaagcgctcaggtgga
aaaggagggatctacgttcaggctgcaaacagtgacagtgcccagggctctgatgtgtct
ctcacggcttctaaagcgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520746
Entry
107520746         CDS       T06036                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, A-30 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107520746
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107520746
   04145 Phagosome
    107520746
  09143 Cell growth and death
   04218 Cellular senescence
    107520746
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107520746
   04612 Antigen processing and presentation
    107520746
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107520746
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107520746
   05330 Allograft rejection
    107520746
   05332 Graft-versus-host disease
    107520746
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107520746
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107520746
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107520746
   05170 Human immunodeficiency virus 1 infection
    107520746
   05168 Herpes simplex virus 1 infection
    107520746
   05163 Human cytomegalovirus infection
    107520746
   05167 Kaposi sarcoma-associated herpesvirus infection
    107520746
   05169 Epstein-Barr virus infection
    107520746
   05165 Human papillomavirus infection
    107520746
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107520746
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107520746
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107520746
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107520746
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 MHC_I_3 C2-set_2 ig DUF2514 Psg1 Ig_2
Other DBs
NCBI-GeneID: 107520746
NCBI-ProteinID: XP_016020370
LinkDB
Position
Unknown
AA seq 363 aa
MRVMGPRTLLLLLSGALALTETWAGSHTLRYFSTTWFRSGSGETRLVTVGYVDDMQFARL
DSDAASPREVLWAPWMERMVQEDPQYRDQETRNLQGIAQYFRTTLTTLRGHYNQSEAGSH
TIQGICGCDVGPDGRFRRGYKQFAYDGAYYIALNEDLRSWTAAKVAAQITRRKWEEAAVA
ERIRAYLEGTCVEQLLRYLEKGKETLQRADPPKTRVTHHPISDGEVTLRCWALGFYPAEI
TLTWQRDGEDQTQDMELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLTLR
WEPPLATIPTVVVIAALVLLGTVVTGAVVGAVMWKRKRSDRDSAQGSDMSLTASKARDSG
LVG
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgcgggtcatggggccccgaactctcctcctgctgctctcgggagccctggccctgacc
gagacctgggcgggttcccacaccctgaggtatttcagcaccacttggttccggtccggg
agtggagagacgcgcttggtcactgtcggctacgtggacgacatgcagttcgcgcggtta
gacagcgacgccgcgagtccgagggaggtgctgtgggcgccgtggatggagcggatggtg
caggaggatccgcagtatcgggaccaggagacacggaacttacagggcatcgcacagtat
ttccgaacgaccctgacaacactgcgcggtcactacaaccagagcgaggccgggtctcac
accatccagggcatatgcggctgcgacgtggggccggacgggcgcttccgccgaggttac
aagcagttcgcctacgacggcgcctattatatcgcgctgaacgaggacctgcgctcctgg
accgcggccaaagtggcggctcagatcacccggcgcaagtgggaggaggccgctgtggcg
gagcgcatcagggcctacctggagggcacgtgcgtggagcagctcctcagatacctggag
aagggcaaggagacgctgcagcgcgcagaccctccaaagacacgcgtgacccaccacccc
atctctgacggtgaggtcaccctgaggtgttgggccctgggcttctaccctgcggagatc
accctgacctggcagcgtgacggggaggaccagacccaggacatggagctcgtggagacc
aggcctgcaggggacgggaccttccagaagtgggcggcagtggtggtgccttctggagag
gagcagagatacacgtgccacgtgcagcacgaggggctgccccagcccctcaccctgaga
tgggagcctcctctggccaccatccccactgtggtcgtcattgctgccctcgtcctcctt
ggaactgtggtcactggagctgtggttggagctgtgatgtggaagaggaagcgctcagac
agagacagtgcccagggctctgatatgtctctcacggcttctaaagcacgagacagcggc
cttgtggggtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521730
Entry
107521730         CDS       T06036                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-15 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04144  Endocytosis
ray04145  Phagosome
ray04218  Cellular senescence
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04940  Type I diabetes mellitus
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107521730
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107521730
   04145 Phagosome
    107521730
  09143 Cell growth and death
   04218 Cellular senescence
    107521730
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107521730
   04612 Antigen processing and presentation
    107521730
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107521730
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107521730
   05330 Allograft rejection
    107521730
   05332 Graft-versus-host disease
    107521730
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107521730
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107521730
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107521730
   05170 Human immunodeficiency virus 1 infection
    107521730
   05168 Herpes simplex virus 1 infection
    107521730
   05163 Human cytomegalovirus infection
    107521730
   05167 Kaposi sarcoma-associated herpesvirus infection
    107521730
   05169 Epstein-Barr virus infection
    107521730
   05165 Human papillomavirus infection
    107521730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107521730
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107521730
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107521730
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Antigens
  107521730
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig Ig_2 MATalpha_HMGbox Abhydrolase_9_N
Other DBs
NCBI-GeneID: 107521730
NCBI-ProteinID: XP_016022180
LinkDB
Position
Unknown
AA seq 330 aa
MRVMGPRPLLLLLSGALALTETWAGSHSMRYFYTAWPRPGSGEPRFVAVGYVDNRQLVWF
DSDAASPRAEPRAPWMEQVELEDPQYLDRSTRIFRDNAQIYRESLNNVRGYYNQSEAGSH
TIQVICGCDVGPDGRLLRGYHQLAYDGADYIALNEDLRSWTAADVAAQITRRKWEEAAVA
ERWRAYLEGMCVEWLLRHLEKGKETLRRADPPKTHVTHHPISDREVTLRCWALGFYPAEI
TLTWQRDGEDQTQDTELMETRPAGDGTFQKWAAVAVPSGEEQRYTCHVQHEGLPQPLTLR
WEPPSTATILILVIIAALVFLGVVAIGAVV
NT seq 993 nt   +upstreamnt  +downstreamnt
atgcgggtcatggggccccgacccctcctcctgctgctctcgggggccctggccctgacc
gagacctgggcgggttcccactctatgaggtatttctacaccgcctggccccggcccggg
agcggggagccccgcttcgtcgccgtcggctacgtggacaacaggcagctcgtgtggttc
gacagcgacgccgcgagtccgagggcggagccgcgggcgccgtggatggagcaggtggag
ctggaggatccgcagtacttggaccggagcacccggatcttccgggacaacgcacagatt
taccgagagagtctgaacaacgtgcgcggctactacaaccagagcgaggccgggtctcac
accatccaggtcatatgcggctgcgacgtggggccggacgggcgcctcctccgcgggtac
catcagctcgcctacgacggcgccgattacatcgcgctgaacgaggacctgcgctcctgg
accgcggccgacgtggcggctcagatcacccggcgcaagtgggaggaggccgctgtggcg
gagcgctggagggcctacctggagggcatgtgcgtggagtggctcctcagacatttggag
aagggcaaggagacgctgcggcgcgcagaccctccaaagacacacgtgacccaccacccc
atctctgaccgtgaggtcaccctgaggtgctgggccctgggcttctaccctgcggagatc
accctgacctggcagcgtgacggggaggaccagacccaggacacggagctcatggagacc
aggcctgcaggcgacgggaccttccagaagtgggcggcagtggcggtgccttctggagag
gagcagagatacacgtgccatgtgcagcacgaggggctgccccagcccctcaccctgaga
tgggagcctccttctacggccactatcctcattttggtcatcattgctgccctggtcttc
cttggagttgtggccattggagctgtggtgtga

DBGET integrated database retrieval system