KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498450
Entry
107498450         CDS       T06036                                 

Gene name
NOTCH4
Definition
(RefSeq) neurogenic locus notch homolog protein 4 isoform X1
  KO
K20996  Notch 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04330  Notch signaling pathway
ray04919  Thyroid hormone signaling pathway
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107498450 (NOTCH4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107498450 (NOTCH4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498450 (NOTCH4)
   05206 MicroRNAs in cancer
    107498450 (NOTCH4)
  09162 Cancer: specific types
   05224 Breast cancer
    107498450 (NOTCH4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107498450 (NOTCH4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107498450 (NOTCH4)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Notch Ank_5 Ank Ank_3 Ank_4 NOD EGF_2 EGF_3
Other DBs
NCBI-GeneID: 107498450
NCBI-ProteinID: XP_015977055
LinkDB
Position
Unknown
AA seq 2001 aa
MQPSSLLLLLLCQSVMKTKGLPCGSFSEPCANGGICLSLSQGLGTCQCAPGFLGETCQFP
DPCHDTQLCQNGGSCQALLPTLPGSPSPPSPLTPSFFCTCPSGFTGERCQAQLKDPCSSF
CSQMGHCYIQSSGRPQCSCLPGWTGEQCQLRDFCSANPCMNGGVCLATYPQIQCRCPPGF
EGHTCEHDVNECFLDPGLCPEGTSCHNTLGSFQCLCPSGQEGPHCELWPGPCPPMGCPNG
GTCQLVPGRDSTFHLCLCPPGFTGPGCEVNSDDCVGHQCQNGGTCQDGLVSYTCLCPEAW
TGWDCSEDVDECETLSPPHCRNGGTCQNSAGSFHCVCVSGWGGTGCEENLDDCVAATCAP
GSTCIDRVGSFSCLCPPGRTGLLCHMEDKCLSQPCHEEAQCSTNPLTGATLCLCQPGYSG
PTCHQDLDECQMAQRGSSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHDECLSQPCHP
GSTCLDLLATFHCLCPPGLEGQLCEVETDECASAPCLNQADCQDQRNGFLCICLPGFTGS
RCEEDINECRSSPCANDGQCQDQPGSFHCECLQGFKGPRCQVEVDECLSSPCTSGASCLD
LPGAFFCLCPSGFTGHLCEFLLCAPNLCQPKQKCQHQEDKAHCLCPDGSPGCAPVEDNCT
CHHGHCQRSSCVCDVGWTGPECEAELGGCVSTPCAQGATCHPQPSGYNCTCPIGYTGPTC
SEEVTACHSGPCLNGGSCSPNPGGYSCTCPPSHTGAHCQTSTDHCASALCLNGGTCVNEP
GTSSCFCATGFRGPRCEERIYPSCADSPCRNMATCQDGPQGPHCLCPTGYTGSSCQTLMD
LCAQKPCAHNSRCLQSGPSFQCLCLQGWTGPHCNIPLSSCQKAALSQGAEVSSLCQNGGR
CIDSGPSYFCHCPPGFQGSMCQERVNPCESRPCEHGATCVAQPSGYLCQCAPGYNGQNCS
EESNACQSQPCHNHGTCTHKPGGFHCICPPGFVGPRCEGDVDECLDQPCHPIGTAACHSL
ANAFYCQCLPGHTGQWCEMEIEPCQSQPCSHGGSCEATAGPSPGFICHCPLGFEGPTCSH
RAPSCGLHHCHHGGLCLPSPKSGFPPRCACLNGYRGPDCLTPPTSEGCGPPSPCLHNGSC
SETSKLGGRGFRCSCPPSSLGPRCQSPRAKGCEGRGGDGACDTGCSGPEGNWDGGDCSLG
VLDPWKGCPSQSRCWLLFRDGQCHPQCDSEECLFDGYDCETAPACTPAYDQFCRDHFHNG
HCEKGCNTPECGWDGGDCRPEDGNSEWGPSLALLVVLSPLALDQQLLALARVLSLTLRVG
LWVRKDSDGRDMVYPYPGAKAEEELGGTPNPSHRERAAPQTQPVSKETDSLSTGFVVVMG
VDLSHCGPDHPASRCPWDPGLLLRFLAGMAAVEALEPLLPGPLLAAHPRTGTTEPANQLP
WPVLCSPVAGVLLLALGALLVLQFMRRRRREHGALWLPPGFTRRPQTQPASRPRRPPLGE
DSIGLKTLKSEAEVEDGVTCSGPEGEVGSQAEERASPAKCQLLPLSGDCQELPQAAMLTP
PQEFEIDVSDVDARGPDGVTPLMSAVCCGGVGSGTFQAAWLESPEPWEPLLGGGACPQAH
TVGTGESPLHLAARFSRPTAAYRLLEAGANPNQPDQAGRTPLHTAVAADAREVCQILLRS
RQTAVDARTEDGTTALMLASRLAVEDLVEELIAAQADVGARDKRGKTALHWAAAVNNARA
ARSLLQAGADKDAQDGREQTPLFLAAREGAVEVAQLLLGLGAARGLRDQAGLTPGDIARQ
RNHWDLLTLLEGARPPETRHKDATGAFARARTASGSVPSRKGVALQRCRTLSAGAVSRGG
GADLQTRTSLVDLAAHGDVAYSQCQILSKGGAGGGPPRHGRRFSAGMRRPRPNPAIIRGR
SGVATGSGGVALADEWPCDWVALGTCSPASNIRISPLCLTPSPERESPQVSWDSPAHRVI
PLSARGEGQKQKANGREELEN
NT seq 6006 nt   +upstreamnt  +downstreamnt
atgcagccctcttcattgttgctgcttctgctgtgtcagtcagtcatgaagaccaaaggg
ctgccgtgtgggagtttctcagaaccctgtgccaatggaggcatctgcctgagcctatct
caaggcctaggcacctgccagtgtgcccctggcttcctgggtgagacatgccagtttcct
gacccctgccatgatactcagctctgccaaaatgggggcagctgccaagccctgctcccc
accctcccaggttcccccagccctccctctcccctgacccccagcttcttctgcacctgc
ccctctggcttcactggtgagcggtgccaggcccagctcaaggacccctgttcttccttc
tgttcccaaatgggccactgctacatccagtcctcaggacgtccacagtgctcctgcttg
cctggatggacaggtgagcagtgccagcttcgggacttctgttcagccaacccctgcatg
aatggaggggtatgtctagccacctacccccagatccagtgccgctgcccacctggcttc
gagggccatacctgtgaacacgatgtcaacgagtgtttcttagacccaggactctgcccc
gagggcacctcctgccataacaccttggggtccttccagtgtctctgtccctctgggcag
gaaggtccacactgtgagctttggccaggaccttgcccaccaatgggctgtcccaatgga
ggcacctgccagctggttccagggagagattccaccttccacctctgcctctgtccccca
ggtttcacaggcccaggctgtgaggtaaattcagatgactgtgtcgggcaccaatgtcag
aacgggggtacttgccaggatggactggtctcctacacctgcctctgcccagaggcctgg
acaggctgggattgctctgaagatgtagacgaatgtgagaccctgagtccccctcactgc
agaaacgggggtacctgccagaactcggctggcagcttccattgtgtgtgtgtgagtggc
tggggaggcacaggctgtgaagagaacctagatgactgtgttgctgccacctgtgcccca
ggatccacctgcattgaccgcgtgggctccttctcctgcctctgcccacctggccgcaca
ggcctcctgtgtcacatggaggacaagtgtctaagtcagccatgccacgaggaagcccag
tgcagcaccaaccccctgacaggagccacactctgcttgtgtcagcctggctactcaggg
ccaacctgccaccaggacctggacgagtgtcagatggctcagcgaggctccagtccttgt
gaacatggcggctcctgcctcaacacccccggctcctttaactgcctctgtccccctggc
tacacgggctcccgctgcgaggctgatcacgatgaatgcctgtcccagccctgccaccca
ggcagcacctgcctggacctgctggccaccttccactgcctctgcccaccaggcttagaa
gggcagctctgtgaggtggagacagatgagtgtgcctcggctccttgcctgaatcaggct
gattgtcaagaccagcgcaacggcttcctgtgcatctgcctgcccggattcacaggctcc
cggtgtgaggaggacatcaatgagtgcagaagctctccctgcgccaatgatgggcagtgc
caggaccagcctggatccttccattgcgagtgtctccaaggcttcaaaggcccgcgctgt
caggtggaggtggatgagtgtctgagtagcccatgtaccagtggcgccagctgccttgat
ctcccaggagccttcttttgcctgtgcccctctggcttcacaggtcatctctgtgagttt
ctcctgtgtgcccccaacctatgccagcccaaacaaaaatgtcagcatcaggaggacaag
gcccactgcctctgccctgatggaagccctggctgtgcccctgttgaggacaactgcact
tgccaccatgggcactgccagagatcctcatgtgtgtgtgacgtgggttggacaggacca
gagtgtgaggcagagctggggggttgtgtctccacgccctgtgcccagggggcaacttgc
cacccccagccttctggctacaactgcacctgccccataggctatacagggcccacctgc
agtgaggaggtaacagcttgtcactctgggccctgtctcaatggtggctcctgcagcccc
aaccctggaggctactcttgcacctgccctccaagccacaccggggcccactgtcagacc
agcactgaccactgtgcctctgccctgtgcctcaatgggggcacctgtgtgaacgagcct
ggcacctcatcctgcttctgtgccacgggcttccgaggcccacgctgtgaggaaaggatc
tatcccagctgtgcagacagcccctgtaggaacatggctacctgccaagatggcccccag
ggtccccactgcctctgccccactggatatacaggaagcagctgtcagactctgatggac
ttatgtgcccagaagccctgtgcacacaattcccgctgcctccagtctggaccctccttt
cagtgcctgtgcctccagggatggaccgggcctcactgcaacattccactctcctcctgc
cagaaggccgccctgagccaaggcgcagaagtctcttccctgtgccagaatggaggccgc
tgcatcgacagtggcccctcctatttctgtcactgtccccctggattccaaggcagcatg
tgccaggagcgggtaaacccatgcgagtccaggccctgcgagcatggggccacatgtgtg
gcccagcccagtgggtatctctgccagtgtgccccaggctacaatggacagaactgttca
gaggaatccaatgcttgtcaatcccagccctgtcacaaccatggaacttgcacccacaaa
cctggaggtttccactgcatctgccctccaggctttgtggggccgcgctgtgagggggac
gtggatgagtgtttggaccagccctgccaccccataggcactgcagcctgccactctcta
gccaatgccttctactgccagtgtctgcctggacatacaggccagtggtgtgaaatggag
atagagccctgccagagccagccctgctcccatggagggtcttgtgaagccacagcagga
ccatccccaggttttatctgccattgccccctgggttttgaaggacccacctgcagccac
agagctccctcctgtggcctccatcactgccaccacggtggcctgtgtctgccctccccc
aagtctggctttccaccccgctgtgcctgcctcaatggctacagaggccctgactgcctg
actccacccacttctgaaggctgtggccctccttctccatgcctacacaatggcagctgc
tcagagacctctaagctggggggccgaggctttcgatgctcctgccctcccagctcctta
ggtccccggtgtcagagccccagagcaaaaggatgtgagggcagaggtggagatggggcc
tgcgacacaggatgcagtggaccggaaggaaactgggatggtggggactgttccctgggt
gtcctggacccctggaagggctgcccctctcaatcccgctgctggcttctcttccgagat
gggcagtgccatccacaatgtgactctgaagaatgtttgtttgacggctatgactgtgag
actgctccagcctgcaccccagcctatgaccagttctgccgtgatcacttccacaatggg
cactgcgagaaaggctgcaacactccagaatgtggctgggatgggggtgactgcaggccc
gaagatgggaattcagagtgggggccctccctggccctactggtggtgctgagcccccta
gccctggaccagcagctgcttgccctggcccgggtgctgtccttgactctgagggtgggt
ctctgggtgaggaaggatagtgatggcagggatatggtatacccctatcctggggccaag
gctgaagaggagctaggaggaaccccaaacccttctcatcgggagagggcagcccctcaa
acacagcctgtgagcaaggagacagactccctcagcacagggtttgtggtggtaatgggt
gtggatttgtcccactgtggtcctgaccaccctgcatctcgctgcccctgggaccctggg
ctcctgctccgctttcttgccggaatggctgcagtggaggccctggaaccccttctgcca
ggccccctgctggctgcccaccctcgcacaggcaccacggaacctgccaaccagctcccc
tggcctgtactgtgctcgccagtggctggggttctgctcctggcccttggggctcttctc
gtcctacagttcatgcggcggcggcgacgagagcatggggccctctggctgccccctggg
ttcactcgaaggcctcagactcagccagcttcccgcccacgccggcccccactgggagag
gacagcattggcctcaagacactaaaatcagaggctgaagttgaagatggagttacgtgc
tcaggccctgaaggagaggtgggtagccaggctgaagaaagggcctcacccgccaagtgc
cagctcttgcctctgagtggtgactgtcaggagctcccccaggcagccatgctgactcct
ccccaggaatttgagatagatgtctctgacgtagatgcccgtggacctgatggggtgaca
cctctgatgtcagcagtctgctgtgggggagtaggatctgggacctttcaggcagcatgg
ctggagagccctgaaccctgggaacctctgttaggtggaggggcttgtccccaagctcac
actgtgggcactggggagagccccctgcacctggctgccagattctcccggccaactgct
gcctatcgcctccttgaggctggagccaaccccaaccagccagaccaagcagggcgtact
ccccttcacactgctgtagctgctgatgctcgagaggtctgccagatcctactccgcagc
agacagaccgcagtggatgcacggacagaggatgggaccacagcgctaatgctggcctcc
aggctggcggtggaagaccttgttgaagaactgattgcagcccaagcggatgtgggggcc
agagataaacggggaaaaaccgcgctgcattgggccgccgccgtgaacaacgcccgggcc
gcccgctcccttctccaggccggagccgataaagacgcccaggacggcagggagcagaca
ccactgtttctggcggcccgagaaggggcagtggaggttgctcagctgctgctgggactg
ggggcggcccgagggcttcgggaccaggcaggactaacgccaggggacatcgcccgccag
cggaaccactgggatctgctgacactactagaaggagcgaggccgcccgagacacgtcac
aaagacgcgacgggtgctttcgcgcgtgcgcggacggcgtcgggaagcgtgccgtcgcgc
aagggcgtggctctgcagcgctgccggacgttgtcagcaggcgcagtctctcgtggaggc
ggggcagatctacaaacccggacttcgttggttgatctagccgctcatggggatgtggcc
tattcgcagtgccagatcctatcaaaaggaggagcaggaggaggcccgccccgccacggc
cggaggttttctgcaggcatgcgcaggcctcggcccaaccctgcaataatacgaggaaga
tccggggtcgcgaccggtagtgggggtgtggccttagctgatgagtggccctgcgattgg
gtggccctgggaacctgcagtccagcctccaacattcggatctcacctctttgccttact
ccgtctccggagcgggaatcccctcaagtttcgtgggattcgccagcccaccgtgtaata
cccttaagtgcaagaggtgagggtcaaaaacagaaagccaacggcagggaagaattggaa
aactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514333
Entry
107514333         CDS       T06036                                 

Gene name
NOTCH2
Definition
(RefSeq) neurogenic locus notch homolog protein 2 isoform X1
  KO
K20994  Notch 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04330  Notch signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04919  Thyroid hormone signaling pathway
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107514333 (NOTCH2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107514333 (NOTCH2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107514333 (NOTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514333 (NOTCH2)
   05206 MicroRNAs in cancer
    107514333 (NOTCH2)
  09162 Cancer: specific types
   05224 Breast cancer
    107514333 (NOTCH2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107514333 (NOTCH2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107514333 (NOTCH2)
SSDB
Motif
Pfam: EGF hEGF EGF_CA DUF3454 Notch Ank_2 Ank NOD Ank_5 EGF_2 NODP Ank_3 Ank_4 cEGF EGF_3
Other DBs
NCBI-GeneID: 107514333
NCBI-ProteinID: XP_016007404
LinkDB
Position
Unknown
AA seq 2051 aa
MANSNPCEHAGKCVNTDGAFHCECLRGYAGPRCEMDVNECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEVDECQSNPCVNSGQCVDRVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICSPGYM
GAICSDQVDECHSSPCLNEGRCIDLVNGFQCNCQPGTSGVYCEINFDDCASNPCVHGACL
DGVNRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCKCPEGPHHASCYSQ
VNECLSDPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDRNECLSNPCQNGGTCDNLVNGYR
CACKKGFKGYNCQVNINECASNPCLNQGTCLDDVSGYTCHCALPYTGRNCQTVLAPCTPN
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECVSKPCMNRGLCHNTQGSYVCECP
PGFSGLDCEEDVDDCLANPCQNGGSCADGVNAFSCLCLPGFTGDKCQTDVNECLSEPCRN
GGTCSDYVNSYTCKCQAGFEGVHCENNLDECTESSCFNGGTCVDGVNAFSCLCPVGFTGP
FCLHEINECDSHPCLNDGVCVDGLGTYRCTCPLGYTGKSCETMVNLCSRSPCKNKGTCIQ
EKAESWCLCPSGWTGAYCDVPNVSCEVAASRRGLPADRLCQHAGVCINAGRSHHCQCPLG
YTGSYCEEQLDECASHPCQHGATCSDFIGGYGCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENVDDCARGPRCLNGGQCVDRIGGYSCRCLPGFAGAH
CEGDINECLSSPCSSEGSLDCVQLVNDYRCVCRSAFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCVPTAAGPRCFCASPQDCGGGCAS
SPCQHGGSCSPQRRPPYYSCRCPPPFAGSRCELPAAATSTPAATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTVEDPWANCSSLLPCWDYVNGQCDELCNTAECLFDNFECQGSS
KTCRYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGALVVVVLLPPEQLLQ
DARSFLRALGALLHTSLRIKRDAQGGLMVYPYYGERSAATRRPRVARRSLPREDEQEVAG
SKVFLEIDNRQCVQDSDQCFKSTDAAAALLASHAIQGTLSYPLVSVVSEVVAPRHPQLLY
LLAVAVVLILFILLLGVILAKRKRKHGALWLPEGFTLRRDASNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVNEDGPQAKKAKAEDEALLSEDDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDMSEEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELISCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKVLLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLEEHSVAPSPPGAALASALPPVVCGPNRPFLSLKHAPMG
KKPRRPNAKNAMPTSLPNLAKEAKEAKGSRRKKSLSDKGQLSESSVTLSPVDSLESPHTY
VSDATSSPMITSPGLLQASPGPLLAAAAPPGPVHAQHALPFPGLHEVRPVARGAGTALPS
VSQLLPHHHMAPPGGGAAGSVGRLHPVPAPVDWLSRMEVNEAQYSEVFGMVLAPAEGGPA
GIAPQSRPPEGKHVAAPREPLPPIVTFQLIPKGGIAPPAGTAQPQASCPPAVAGPLPAMY
QIPEMARLPSMAFPTAMMPQQDGQVTQTILPTYHPFPASVGKYPTPPSQHSYASSSAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGAGQRGPGTHMS
EPPPSNMQVYA
NT seq 6156 nt   +upstreamnt  +downstreamnt
atggccaacagcaacccttgcgagcacgcggggaagtgcgtgaacacggacggcgccttc
cactgcgagtgcctgagaggctacgcggggccgcgctgcgagatggacgtcaacgagtgc
cattcggacccctgccagaacgacgccacctgcctggacaagatcgggggcttcacctgc
ctgtgcatgccaggtttcaaaggcgtgcactgcgagctggaggtggacgaatgccagagc
aacccctgcgtgaacagcgggcagtgcgtggacagggtcaaccgcttccagtgcctgtgt
ccgccgggtttcaccgggccggtgtgccagatcgacattgacgactgctccagcaccccg
tgtctgaacggggcgaagtgcatcgatcaccccaacggctacgagtgccagtgcgccaca
gggttcaccggcgtgctgtgcgaggagaacatcgacaactgcgaccccgacccctgccac
cacggccagtgtcaggacgggatcgactcgtacacctgcatctgcagcccgggctacatg
ggcgccatctgcagcgaccaggtcgacgagtgccacagcagcccctgcctgaacgagggc
cgctgcatcgacctggtgaacggcttccagtgcaactgccagccgggcacgtcgggcgtc
tactgtgaaatcaattttgatgactgcgccagtaacccttgcgtccacggagcctgcctg
gacggagttaaccggtacagctgcgtctgctccccggggttcacagggcagagatgcaac
atcgacattgatgagtgtgcctccaacccctgccgcaagggcgccacgtgcatcaacgac
gtgaatgggttccgctgcaaatgccccgaggggccccatcacgccagctgctactcacag
gtgaacgagtgcctgagcgatccctgcatccacgggaactgcaccgggggcctcagcgga
tacaagtgcctctgtgatgcaggctgggtcggcgtcaactgcgaagtggacagaaatgag
tgtctctcgaacccatgccagaatggaggcacttgtgacaatctggtgaacggatacagg
tgtgcttgcaagaagggctttaaaggctacaactgtcaggtgaatatcaacgaatgtgct
tcgaacccgtgtctgaaccaggggacctgcttggacgacgtaagcggctacacttgccac
tgcgccctgccgtacacgggcaggaactgtcagaccgtgttggctccctgcacccccaac
ccttgcgagaacgctgccgtttgcaaagagtcaccaaattttgagagttacacctgcctg
tgcgctcctggctggcaaggtcagcggtgcacgattgacatcgacgagtgcgtctccaag
ccctgcatgaaccgcgggctctgccataacacccagggcagctacgtgtgcgagtgtccc
cccggcttcagcggcctggactgcgaggaggacgtcgacgactgcctggccaatccctgc
cagaacggaggttcctgcgcggacggggtgaatgcgttctcctgcctgtgccttccgggc
ttcacgggggacaagtgccagacagacgtgaacgagtgtctgagcgagccctgcaggaat
ggcgggacctgctccgactacgtcaacagttacacctgcaagtgccaggcgggcttcgag
ggcgtccactgcgagaacaacctcgacgagtgcaccgagagctcctgtttcaacggcggc
acgtgcgtcgatggggtgaacgctttctcttgcctctgccccgtgggcttcacgggcccg
ttctgcctgcacgagatcaacgagtgcgactcccacccgtgcctgaacgacggcgtgtgc
gtcgacggcctgggcacctaccgctgcacctgccctttgggctacaccgggaaaagctgc
gagaccatggtgaacctctgcagtcggtccccgtgtaaaaacaaaggtacctgcatccag
gagaaagccgagtcctggtgcctgtgtccgtccgggtggactggtgcttactgcgacgtg
cccaacgtctcctgcgaggtggcggcctcccgcagaggcctgcccgccgaccgcctgtgc
cagcacgcgggcgtctgcatcaacgccggccgctcgcaccactgccagtgccccctgggc
tacacggggagctactgcgaggagcagctggacgagtgcgcgtcccacccctgccagcac
ggcgccacctgcagcgacttcatcggagggtacgggtgcgagtgtgtcccgggctaccag
ggcgtcaactgcgagtacgaggtggacgagtgccagaaccagccgtgccagaacggaggc
acctgcatcgacctggtgaaccacttcaagtgctcctgcccgccaggcacccggggcctg
ctctgcgaagagaacgtcgacgactgcgcccggggcccccgctgcctcaacggcgggcag
tgcgtggacaggatcggggggtacagctgccgctgcctgcccggcttcgccggggcgcac
tgcgagggggacatcaacgagtgcctgtccagcccctgcagctctgagggcagcctggac
tgcgtgcagctcgtcaacgactaccggtgtgtctgccgcagcgccttcaccggtcggcac
tgcgaaacgttcgtcgacgtgtgtccccagatgccctgcttgaacggaggcacgtgtgcc
gtggccagcaacatgcccgacggcttcatctgccgctgtcccccgggcttctccggggcg
cggtgccagagcagctgtggacaggtgaagtgccgccgaggggagcagtgcgtgcccacg
gccgcgggcccccgctgcttctgcgccagcccgcaggactgcggcgggggctgcgccagc
agcccctgccagcacgggggcagctgctccccgcagcgccggccgccctactactcctgc
cgctgccccccgccgttcgcgggcagccgctgcgagctccccgcggccgccaccagcacc
ccggccgccacctgcctgagccagtactgcgccgacaaagcccgggacggcgtctgcgac
gaggcctgcaacagccacgcctgccagtgggacggaggcgactgctccctcaccgtggag
gacccctgggccaactgctcgtccctgctgccctgctgggactacgtgaacggccagtgc
gacgagctgtgcaacacggccgagtgcctgttcgacaacttcgagtgccagggcagcagc
aagacgtgcaggtacgacaagtactgcgcagaccacttcaaggacaaccactgcgaccag
ggctgcaacagcgaggagtgcggctgggacgggctggactgcgccgccgaccagcccgag
aacctggcggagggggcgctggtcgtggtggtgctgctgccgcccgagcagctgctccag
gacgcgcgcagcttcctgcgggcgctgggcgccctgctgcacaccagcctgcgcatcaaa
cgggacgcccagggcggcctcatggtctacccctactatggcgagaggtccgccgccacg
cggaggccgagggtggcacgcaggtccctgccccgcgaggacgagcaggaggtggccggc
tcgaaggtgtttctggagatcgacaaccgccagtgcgtccaggactcggaccagtgcttc
aagagcacggacgcggccgccgctctgctggcctctcacgccatccaggggaccctgtcc
tacccgctcgtgtctgtcgtcagtgaggtcgtggctcccagacacccgcagctgctgtac
ctgctcgccgtggccgtggtcctcatcctgttcatcctgctgctgggggtgatcctggcg
aagcgcaagcggaagcacggcgcgctctggctgcccgaaggcttcaccctgcgccgggac
gccagcaaccacaagcgccgcgagccggtcgggcaggacgccgtggggctgaaaaacctt
tccgtgcaagtctcggaggccaatctcatcggttcgggaacgagcgagcactgggtcaac
gaggacgggccccaggcgaagaaagccaaggctgaagatgaggctctgctctcagaagac
gacgaccccatcgaccgacgtccgtggacgcagcagcacctcgaggccgcagacatccgc
aggactccgtcgctggctctcaccccgcctcaggccgagcaggaggtggacgtgctggac
gtgaacgtccggggcccagatgggtgcacccccctgatgctggcttctctccgaggaggc
agctcagacatgagcgaggaagacgaagacgccgaggactcctctgccaacatcatcacg
gacttggtctaccagggcgccagcctccaggcccagacggaccgcaccggtgagatggcc
ctgcacctcgcggcccgctactcgagggcggacgccgccaagcgcctcctggacgcgggc
gccgacgccaacgcccaggacaacatgggccgctgccctctgcacgccgcggtggcagcg
gacgcccagggcgtcttccagattctgatccgcaaccgagtgaccgacctcgacgccagg
atgaacgacggcacgacgccgctgatcctggccgctcgcctggccgtggaggggatggtg
gccgagctgatcagctgccaggcggacgtgaacgcggtggatgaccacggaaaatccgcc
cttcactgggcagccgctgtcaataacgtggaggcgaccctcttgctgttgaaaaacggg
gccaaccgagacatgcaggacaacaaggaagagacgccgctgttcctcgctgcccgggag
ggaagctacgaagccgccaaggtcctgctggaccacttcgccaaccgggacatcacggac
cacatggaccggctgccccgcgacgtggcgcgggaccgcatgcaccacgacatcgtgcgc
ctgctggaggagcacagcgtggcgcccagccccccgggcgccgcgctggcctccgccctg
ccgcccgtcgtctgcgggcccaaccgccccttcctcagtctgaagcacgccccgatgggc
aagaagcctcgacggcccaacgccaagaacgccatgcccaccagcctccctaacctcgcc
aaggaggccaaggaggccaagggaagcaggaggaagaagtccctgagcgacaagggccag
ctgtccgagagctcggtgactctgtccccggtcgattccctagagtcccctcacacgtac
gtgtccgacgccacgtcctccccgatgatcacgtcccccggcctcctgcaggcctccccc
ggccctctgctggccgccgccgcgccccccggcccggtgcacgcgcagcacgcgctgccc
ttccccggcctgcacgaggtccggcctgtggcccgtggggccggcaccgcgctcccctcg
gtgagccagctgctgccacaccaccacatggcgcccccgggcggcggcgctgcggggagc
gtgggccggctgcacccggtccccgccccggtggactggctgagccgcatggaggtgaac
gaggcgcagtacagcgaggtgttcggcatggtcctggctccggccgagggcggccccgcc
ggcatcgctccccagagccggccgcccgaggggaagcacgtggccgcccctcgggagccc
ctgccccccatcgtgactttccagctcattcccaagggcggcatcgccccgccggctggc
acggcccagccccaggccagctgccccccggcggtcgcaggccccctgcccgccatgtac
cagattccggagatggctcgtctgcccagcatggctttccccaccgccatgatgccccag
caggacgggcaggtcacgcagaccatcctcccgacctaccaccccttcccggcctctgtg
ggcaagtaccccacgccgccttcccagcacagctacgcctcctcgagcgcggccgagcgc
acgcccagccacagcgggcacctccagggcgagcacccctacctgaccccgtccccggag
tctcctgaccagtggtcaagttcctcgccccactctgcttctgactggtcagacgtgacc
accagccccactcctgggggcgctggcgcaggccagcggggacccgggacgcacatgtct
gagccaccgcccagcaacatgcaggtttacgcgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514882
Entry
107514882         CDS       T06036                                 

Gene name
NOTCH1
Definition
(RefSeq) neurogenic locus notch homolog protein 1
  KO
K02599  Notch 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04330  Notch signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04919  Thyroid hormone signaling pathway
ray05020  Prion disease
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107514882 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107514882 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107514882 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514882 (NOTCH1)
   05206 MicroRNAs in cancer
    107514882 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    107514882 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion disease
    107514882 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107514882 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107514882 (NOTCH1)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Ank_2 Notch Ank DUF3454 NODP NOD Ank_5 Ank_4 Ank_3 EGF_3 cEGF
Other DBs
NCBI-GeneID: 107514882
NCBI-ProteinID: XP_016008560
LinkDB
Position
Unknown
AA seq 2562 aa
MPPLLGPLLCLALLPAFGARGLRCSQPSETCLNGGKCEVFPNGTEACLCGEAFAGQRCQA
HSPCLSAPCKNAGTCHVLERGGVLDYTCSCRLGFSGPLCLTPWDNACLASPCRNGGTCDL
LTLTEYKCRCPPGWSGKTCQQADPCASNPCANGGQCLPFEASYICGCPAGFHGPTCRQDV
NECSQSPGPCLNGGTCLNELGSYRCACRASHTGPHCELPYVPCSPSPCQNGGTCRPTGDT
THECTCLPGFTGQNCEENVDDCPGHGCQNGGTCVDGVNTYNCRCPPEWTGQYCTKDMDEC
QLMPNACQNGGTCHNANGGYSCVCVNGWTGEDCGENIDDCASAACFHGATCHDRVASFYC
ECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLG
ANPCEHKGRCINTLGSFECRCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICM
PGYEGVHCEVNRDECASSPCLQNGRCLDKVNEFLCECPTGFTGSLCQYDVDECASTPCRN
GAKCLDGPNTYTCVCTEGYTGPHCEVDVNECDPDPCHYGSCKDGVATFTCLCQPGYTGHH
CETNINECHSQPCRHGGTCQDRDNAYQCLCLKGTTGPNCEINLDDCASSPCDSGTCLDKI
DGFECACEPGYTGSMCNINIDECAGDPCHNGGTCQDGINGFSCRCPEGYHDPTCLSEVDE
CDSNPCIHGVCRDGLNGYKCDCEPGWSGASCDVNNNECESNPCVNGGTCKDMTSGYVCAC
REGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGAACEAVLAPCAPGPCS
NGGECKASEDYESFSCVCPPGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCHCQAGY
TGRTCETDIDDCRPNPCHNGGSCTDGVDVAFCSCLPGFQGPFCEEDVNECASNPCRNGAN
CTDCVASYTCTCPTGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQ
HDVNECDSRPCLHGGTCQDSYGTYKCSCPQGYTGLNCQNLVRWCDSSPCKNGGRCWQTNA
QYRCECHSGWTGLYCDVPSVSCEVAAWQQGVDVSSLCRNGGLCVDAGTTHHCRCQAGYAG
SYCEDQVDECSPSPCRNGATCTDYPGGYSCECVAGYHGVNCSEEINECLSHPCQNGGTCI
DLTNTYKCSCPRGTQGVHCEVDVDDCSPLIDPVSRGPKCFNNGTCVDQVGGYSCTCLPGF
VGERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNG
GTCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCTSGLHSPTCLCPGAFT
GRQCQFPAGSPCVDGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYGFRGGVGLD
ITPPQIEEACELPECQAEAGNKVCSLRCNNHACGWDGGDCSLNFNDPWQNCTQSLECWKY
FSNGRCDSQCNSAGCLFDGFDCQGTDGQCNPLYDQYCKDHFRDGHCDQGCNSAECEWDGL
DCAEHVPERLAAGTLVLVVLTPPERLRNDSLRFLRELSRLLHTNVVFRRDASGQQMIFPY
YGREEELRKHPIKRSADGGWAAPGALLDQAREALLPGSRWRRELDPMDIRGSIVYLEIDN
RQCVQSSSQCFQSTTDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPSPPLHFMYVAVV
ALVLLIFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNTSD
GALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRVSATAPTP
PQGEADADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHN
QTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIR
NRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVE
AAVVLLKHGANKDMQNNKEETPLFLAAREGSYETAKALLEHCANRDIADHMDRLPRDIAQ
ERMHHDIVRLLDEHGLARSPPLHGAPLGGAPTLSPPLCSPSGYLGSLRPAGPGKKARKPS
TKGLASGGKEARDLKARRKKSQDGKGCLLDSTSLLSPVDSLESPHGYLSDVASPPLLPSP
FQQSPSVPLSHLPGMPDTHLGLSHLGVAAKPEMAALGGGGRLAFEAGPPRLSHLPVASGT
STVLGAGGSSGAVNFAVGGTTGLNGQCEWLSRLQNGLVPNQYNPLRGSVAPGTLSTQAPA
LQHGMIGPLHGGLSATALSQMLSYQALPNTRLTTQPHLVPTQQVQQQQNLQLQQQQSMQP
PPNLQPPNIQQPQNLQPPPPPQPHLGVSAAASGHIGRSFLGGEPSQADVQPLGPSGLAVH
TALPQDSQALATSLPSSLVPPMTTAQFLTPPSQHSYSSSPMDNTPSHQLQVPEHPFLTPS
PESPDQWSSSSPHSNISDWSEGISSPPTSMPSQIAHIPEAFK
NT seq 7689 nt   +upstreamnt  +downstreamnt
atgccgccgctcctcgggcccctgctctgcctggcgctgctgcccgccttcggcgcacga
ggcctgcggtgttcccagcccagcgagacctgcttgaatggcgggaagtgtgaagtgttc
cccaacggcacggaggcctgcctctgcggcgaggccttcgcaggccagcggtgccaggcg
cacagcccctgcctcagcgccccctgcaagaacgcgggcacctgccacgtgctggagcgc
ggcggcgtgctggactacacctgcagctgccgcctgggcttctccgggccactgtgcctg
acgccctgggacaacgcctgcctcgccagcccctgccgcaacggcggcacctgcgacctg
ctcacgctcacggagtacaagtgccgctgccccccgggctggtcagggaagacgtgccag
caggctgacccctgcgcctccaacccctgcgccaacggcggccagtgcctgcccttcgag
gcctcgtacatctgcggctgcccggccggcttccacgggcccacctgccggcaggacgtg
aacgagtgcagccagagccccgggccctgcctcaacggcggcacctgcctcaacgagctg
ggctcctatcggtgcgcctgccgcgccagccacaccggcccgcactgcgagctgccctac
gtgccctgcagcccctccccctgccagaacggcggcacctgccggcccacgggggacacc
acgcacgagtgcacctgcctgccagggtttaccggccagaactgcgaggaaaacgtcgac
gactgcccagggcacggctgccagaacgggggcacctgtgtggacggcgtgaacacctac
aactgccgctgcccgcccgagtggacaggccagtactgcaccaaggacatggacgagtgc
cagctgatgcccaacgcctgccagaacgggggcacgtgccacaacgccaacggcggctac
agctgcgtgtgcgtcaacggctggacgggcgaggactgcggcgagaacatcgacgactgc
gccagcgccgcctgcttccacggcgccacctgccacgaccgcgtggcctccttctactgc
gagtgtccccacggccgcaccggcctgctgtgccacctcaacgacgcctgcatcagcaac
ccctgcaacgagggctccaactgcgacaccaaccccgtgaacggcaaggccatctgcacc
tgcccctcggggtacacggggcccgcctgcagccaggacgtggacgagtgctcgctgggc
gccaacccctgcgagcacaaaggcaggtgcatcaacacgctgggctccttcgagtgccgg
tgtctgcagggctacaccgggccccgctgcgagatcgacgtcaatgagtgcgtctcgaac
ccgtgtcagaacgacgccacctgcttggaccagatcggggagttccagtgcatctgtatg
ccgggctacgagggcgtccactgcgaggtgaaccgcgacgagtgtgccagcagcccctgc
ctgcagaacggccgctgcctggacaaggtcaacgagttcctgtgcgagtgtcccacaggc
ttcaccgggagcctctgccagtacgacgtggacgagtgtgcgagtacgccctgcaggaac
ggcgccaagtgcctggacgggcccaacacctacacctgcgtgtgcacggagggctacacg
gggccccactgcgaggtggacgtcaacgagtgcgaccctgacccctgccactacgggtcc
tgcaaggacggcgtcgccaccttcacctgcctgtgtcagccgggctacaccggccaccac
tgcgagaccaacatcaacgagtgccacagccagccctgccgccacgggggcacctgccag
gaccgcgacaacgcctaccagtgcctctgcctcaaggggaccacaggacccaactgtgag
atcaacctggacgactgcgccagcagcccctgtgactcgggcacgtgtctggacaagatc
gatggcttcgagtgtgcgtgcgagccgggctacacagggagcatgtgcaacatcaacatc
gacgagtgtgcgggggacccctgccacaacgggggcacctgccaggacggcatcaacggc
ttcagctgccgctgcccggagggctaccacgaccccacgtgcctgtctgaggtggacgag
tgcgacagcaacccctgtatccacggggtctgccgggacggcctcaacgggtacaagtgt
gactgtgagcccgggtggagtggggcaagctgtgacgtcaacaataacgagtgtgaatcc
aacccctgtgtcaacggcggcacctgcaaggacatgaccagcggctacgtgtgcgcctgc
cgggaaggcttcagtggccccaactgccagaccaacatcaacgaatgcgcgtccaacccc
tgtctgaaccagggcacgtgtatcgacgacgtggcggggtacaagtgcaactgcccgctg
ccctacacaggagccgcgtgcgaggcggtgctggccccgtgcgcccccggcccctgcagc
aatggtggtgagtgcaaggcatccgaggactacgagagcttttcctgcgtctgcccgccg
ggctggcaagggcagacgtgcgaggtcgacatcaacgagtgtgtgaagagcccgtgccgc
cacggagcctcctgccagaacaccaacggcagctaccgctgccactgccaggcggggtac
acggggcgcacctgcgagacggacatcgacgactgccggcccaacccatgccacaacggt
ggctcctgcacggacggcgtcgacgtggccttctgcagctgcctgcccggcttccagggc
cccttctgcgaggaggacgtgaacgagtgcgccagcaacccctgccgcaacggcgccaac
tgcacggactgcgtggccagctacacctgcacctgccccacgggcttcagcgggatccac
tgcgagaacaacacgcccgactgcacggagagctcctgcttcaacggtggcacctgtgtg
gacggcatcaactccttcacctgcctgtgtccacctggcttcacgggtagctactgccag
cacgacgtcaacgagtgtgactcgcgtccctgcctgcacggcggcacctgccaggacagc
tacggcacgtacaagtgcagctgcccgcagggctacaccggcctcaactgccagaacctc
gtgcgctggtgcgactcctcgccctgcaagaacggcggcaggtgctggcagaccaacgcc
cagtaccgctgcgagtgccacagcggctggaccggcctctactgcgacgtgcccagcgtg
tcctgcgaggtggccgcgtggcagcaaggcgtggacgtgagcagcctgtgccggaacggg
ggcctctgcgtggacgccggcaccacgcaccactgccgctgccaggcgggctacgccggc
agctactgcgaggaccaggtggacgagtgctcgcccagcccctgccgcaacggcgccacc
tgcacggactaccccggcggctactcctgcgagtgcgtggccggctaccacggggtgaac
tgctccgaggagatcaacgagtgcctgtcccacccgtgccagaatgggggcacctgcatc
gacctcaccaacacatataagtgctcctgcccccggggcactcagggcgtgcactgcgag
gtggacgtggacgactgcagccccctcatcgaccccgtgtcccggggccccaagtgcttc
aacaatggcacctgcgtggaccaggtgggcggctacagctgcacctgcctgcccggcttc
gtgggcgagcgctgtgagggcgacgtcaacgagtgtctgtccaacccctgtgacgcccgc
ggcacccagaactgcgtgcagcgcgtcaacgacttccactgcgagtgccgtgccggccac
accgggcgccgctgcgaatcggtcatcaacggctgcaaagggaagccgtgcaagaatggg
ggcacctgcgccgtggcctccaacacagcccgcgggttcatctgcaagtgcccggcgggc
ttcgagggcgccacctgtgagaacgatgcgcgcacctgtggcagcctgcggtgcctgaac
ggcggcacctgcacctcgggcctgcacagccccacctgcctgtgcccgggcgccttcacc
ggccgccagtgccagttcccggctggcagcccctgcgtggacggcaacccctgctacaac
cagggcacctgcgagcccacgtccgagagcccgttctaccgctgcctgtgtcccgccaag
ttcaacgggctcctgtgccacatcctggactatggcttccgggggggcgtggggctggac
atcaccccgccgcagatcgaggaggcgtgcgagctgcccgagtgccaagcagaggccggc
aacaaggtctgcagcctgcgctgcaacaaccacgcgtgcggctgggacggcggcgactgc
tccctcaacttcaacgacccgtggcagaactgcacgcagtcgctggagtgctggaagtac
ttcagcaacggccgctgcgacagccagtgcaactcggccggctgcctcttcgacggcttc
gactgccagggcacggacggccagtgcaacccgctgtacgaccagtactgcaaggaccac
ttcagggacgggcactgcgaccagggctgcaacagcgccgagtgcgagtgggacgggctg
gactgcgcggagcacgtgccggagcggctggcggccggcacgctggtgctggtggtgctg
acgccgcccgagcggctgcgcaacgactcgctccgcttcctgcgcgagctcagccgcctg
ctgcacaccaacgtggtcttcaggcgcgacgccagcggccagcagatgatcttcccctac
tacggccgcgaggaggagctgcgcaagcaccccatcaagcgctccgcggatggcggctgg
gccgcgcccggcgccctgctcgaccaggccagggaagcgctgctgccgggcagccgctgg
cgcagggagctggatccgatggacatccgcgggtccatcgtctacctggagatcgacaac
cggcagtgcgtccagtcctcctcgcagtgcttccagagcaccacagacgtggccgccttc
ctgggggcgctggcctcgctcggcagcctgaacatcccctacaagatcgaggccgtgcag
agtgagacggtggagccgccgccgtccccaccgctgcacttcatgtacgtggccgtggtc
gccctcgtcctgctgatcttcgtgggctgcggggtcctgctgtcccgcaagcgtcggcgg
cagcatggccagctctggttccccgagggcttcaaggtgtcggaggccagcaagaagaag
cggcgggagcccctgggcgaggactccgtgggcctcaagcccctgaaaaacacctcggac
ggcgccctcatggatgacaaccagaacgagtggggtgacgaggacctggagaccaagaag
ttccggttcgaggagccagtggttctccctgacctggacgaccagacagaccaccgccag
tggacccagcagcacctggacgccgccgacctgcgtgtgtccgccacggcccccacgccg
ccccagggcgaggccgacgccgactgcatggacgtcaacgtccgtgggccggacggcttc
acgcctctcatgatagcctcgtgcagcggagggggcctggagacgggcaacagcgaggag
gaggaggacgcaccggccgtgatctcggacttcatctaccagggcgccagcctgcacaac
cagacggaccgcaccggcgagaccgccctgcacctggccgcccgctactcgcgctccgac
gcggctaagcgcctgctggaggccagtgccgacgccaacatccaggacaacatggggcgc
acgccgctgcacgcggccgtgtccgccgatgcccagggcgtgttccagatcctgatccgg
aaccgagccacagacctggacgcccgcatgcacgacggcacgacaccgctgatcctggcc
gcccggctggccgtcgagggcatgctggaggacctcatcaactcccacgccgacgtcaac
gccgtggacgacctgggcaagtccgccctgcactgggccgcggccgtgaacaacgtggag
gccgccgtggtgctgctgaagcacggggccaacaaggacatgcagaacaacaaggaggag
acgccgctgttcctggccgcccgggagggcagctacgagacggccaaggcgctgctggag
cactgcgccaaccgggacatcgccgaccacatggaccgcctgccgcgggacatcgcgcag
gaacgcatgcaccacgacatcgtgcggctgctggacgagcacggcctggcgcgcagcccc
ccgctgcacggcgccccgctgggcggcgcgcccaccctgtcgcccccgctctgctcgccc
agcggctacctgggcagcctcaggcccgccgggccgggcaagaaggcccgcaagcccagc
accaagggcctggctagtggaggcaaggaggccagggacctcaaagcacggaggaagaag
tcccaggacggcaagggctgcctgctggacagcacgagcttgctgtcccccgtggactcc
ctcgagtcgccccacggctacctgtcggacgtggcctcgccacccctcctgccctcgccc
ttccagcagtctccgtcggtgcccctgagccacctgccgggcatgcccgacacccacctg
ggcctcagccacctgggagtggcggccaagcccgagatggccgcgctgggcgggggcggc
cggctggccttcgaggctgggccgccacgcctctcccacctgccggtggcctccggcacc
agcacagtcctgggtgctggcggtagtagcggggccgtgaattttgccgtgggtggaacc
acgggcttgaacggccagtgcgagtggctgtcccgactgcagaatggcctggtgccaaac
cagtacaacccgctgcgagggagcgtggccccgggcacgctgagcacacaggcccctgcc
ctgcagcatggcatgataggcccgctgcacggcggcctctccgccactgccctgtctcag
atgctgagctaccaggccctgcccaacacgcggctgaccacccagcctcacctggtgccg
acccagcaggtgcagcagcagcagaacttacagttgcagcagcagcaaagcatgcagccg
ccgccgaacctgcagccacccaacatccagcagccgcagaacctgcagccgccaccgccg
ccccagccacaccttggcgtgagcgcggctgccagcggccacatcggccggagcttcctg
ggtggggagccgagccaggccgacgtgcagccgctgggccccagcggcctggcggtgcac
accgccctgccacaggacagccaagccctggccacgtcgctgccatcctccctggtcccg
cccatgaccactgcgcagttcctcacgccgccctcacagcacagctactcttcctctccc
atggacaacacccccagccaccagctgcaggtgcccgagcaccccttcctcaccccgtcc
cccgagtcccccgaccagtggtccagctcgtccccacactccaacatctccgactggtcc
gagggcatctccagcccgcccaccagcatgccgtcccagatcgcccacatcccggaggcc
ttcaagtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517220
Entry
107517220         CDS       T06036                                 

Gene name
NOTCH3
Definition
(RefSeq) neurogenic locus notch homolog protein 3 isoform X1
  KO
K20995  Notch 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04330  Notch signaling pathway
ray04371  Apelin signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04919  Thyroid hormone signaling pathway
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107517220 (NOTCH3)
   04371 Apelin signaling pathway
    107517220 (NOTCH3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107517220 (NOTCH3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107517220 (NOTCH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107517220 (NOTCH3)
   05206 MicroRNAs in cancer
    107517220 (NOTCH3)
  09162 Cancer: specific types
   05224 Breast cancer
    107517220 (NOTCH3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107517220 (NOTCH3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107517220 (NOTCH3)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Notch Ank EGF_2 Ank_5 NODP DUF3454 NOD Ank_3 Ank_4 cEGF FXa_inhibition EGF_3
Other DBs
NCBI-GeneID: 107517220
NCBI-ProteinID: XP_016013169
LinkDB
Position
Unknown
AA seq 2321 aa
MGPGARGRHRRLMSPLPPLPSVRALPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPSRD
AACLCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDP
CLSSPCAHGARCSVGPDGRYICSCPPGYQGRSCRSDVDECRVGGPCRHGGTCLNTPGSFR
CQCPAGYTGPLCENAAVPCAPSPCRNGGTCRQNGDLTYDCACLPGFEGQNCEVNVDDCPG
HRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSCVC
VNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPCHE
DAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGKCVNTQGSFLCQCGRG
YTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDMDECQSSPCVNGG
ICKDRVNGFSCTCPSGFSGAMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTLC
ELNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDLVD
KYLCRCLPGTTGVSCEVNIDDCASNPCTFGICRDGINRYDCVCQPGFTGPLCNVEINECA
SSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAQEPCSHGVCHDAPGGFRCECEP
GWSGPQCSQSLAQDACESQPCGAGGTCTSDGMGFHCICPPGVHGHQCELLSPCTPNPCEH
GGHCESAPGQLAICSCPPGWQGLRCQQDVDECASPSPCGSHGTCTNLAGSFSCTCLRGYS
GPSCDQDINDCDPNPCLNGGSCQDHVGSFSCSCLPGFAGPRCARDVDECLSSPCGPGTCT
DHVASFTCTCPPGYGGFRCEQDLPNCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQHE
ADPCLSRPCLHGGVCTATHSGFRCACPEGFTGTQCQTLVDWCSRAPCQNGGRCARTGTSF
YCLCPPGWSGSLCDIQSLPCREAAAQMGVRMEQLCQAGGHCVDKDSSHYCVCPEGRTGSH
CEQEMDPCLARPCQHGGTCRGYMGGYVCECPAGYAGDNCEDDVDECASQPCQHGGFCIDL
VARYLCSCPAGTLGVLCEINEDDCGPGLPLDLHPQCLHNGTCVDLVGGFRCTCPPGYTGL
RCEADINECHPGACHAAHTRDCLQEPGGGFRCLCQAGFTGARCQTMLSPCESQPCQHGGQ
CLPSQGPGGALTFACHCIPPFSGSRCERVARSCRELQCPVGVPCQLTVRGPRCACPPGLS
GPACRGSRESPPGATNASCVASPCLHGGSCRPEPLAPFFRCACVPGWAGQRCEVPAAAPE
APEEPLCPSAACEAKSGDKRCDRECNSPGCGWDGGDCSLSVGDPWRQCSALQCWRLFNNS
RCDPACSSPACLYDNFDCRAGGRERACNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC
AGEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSGILRTSLRFRLDEHGQAMVFPYHR
PGPGSEARNRRELAPEVIGSVVMLEIDNRLCLQSPENNHCFPDAQSAADYLGALSAVERL
DFPYPLRAARGEPLELPEPSVPLLPLLAASAVFLLVILVLGVMVARRKREHSTLWFPEGF
VLHKDMATGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPSVG
AEDTVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCG
GTLEPMPTEEDEAEDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLD
AGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEG
MVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAA
REGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVGLLDQPSGPRSPPGPHGLG
PLLCPPGAFLPGLKAAQSGGKKSRRLPGKTGLGPQGTRGRGKKLTLACPGPLAESSVTLS
PVDSLDSPRPFGGPPASPGGFSLEGPYVGATTTAVSLAQLGGAGRAGLGRQPTGGCVLSL
GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEE
YPAAGAHGSPAKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATGAT
ATAAGTLPAQPLPLSVPGPLVQAQTQLGPQPEATPKRQVLA
NT seq 6966 nt   +upstreamnt  +downstreamnt
atggggccgggggcccggggccgccaccgccgcctgatgtcgccgctgccgccactgccg
tctgtgcgggcgctgcccttattgctgctgctggcagggccaggggctgcagcccctcct
tgcctggatggaagcccgtgtgcgaatggaggtcgctgcacccagctgccctcccgggat
gctgcctgcctgtgcctaccaggctgggtgggtgaacggtgccagttggaagatccctgc
cattcgggcccctgtgctggccgaggtgtctgccagagctcggtggtagcgggcactgcc
cggttctcctgccgctgtccccgtgggttccgaggccctgactgctccctgccggatccc
tgcctcagcagtccctgtgcccatggtgcccgctgctcagtggggccagatggccgctac
atctgctcctgcccacctggctaccagggccgcagctgccgaagtgatgtggatgagtgc
cgagtgggcgggccctgccgtcatggtggcacctgcctcaacacgcctggttcctttcgc
tgccagtgcccagctggctacacagggccactgtgtgagaacgctgcagtgccctgtgct
ccctcaccatgccgtaacgggggtacctgtagacagaatggtgacctcacctatgactgt
gcctgccttccggggttcgagggccagaactgtgaagtgaatgtggatgactgtccaggg
caccgatgtctaaatggggggacatgtgtggatggcgtcaacacctacaactgccagtgc
cctcccgagtggacaggccaattctgcacagaggatgtggatgagtgtcagctgcagccc
aacgcttgccacaatgggggcacctgctttaacacactgggtggccacagctgtgtgtgc
gtcaatggctggactggtgagagctgcagtcagaacatcgatgactgtgctacggctgta
tgcttccatggggccacctgccatgaccgcgtggcctccttttactgtgcctgccccatg
ggcaagactgggcttctgtgtcatctggatgatgcctgtgtcagcaatccctgtcatgag
gatgctatctgcgacacgaacccggtgaatggccgggccatctgtacctgtccaccaggc
ttcacaggcggcgcatgtgaccaggatgtggatgagtgctccattggtgccaacccgtgt
gagcacctgggcaagtgcgtgaacacacagggttcgttcctttgccagtgtggccgtggc
tacaccggcccgcgctgtgagacggatgtcaatgagtgcctatctgggccctgccgcaac
caggccacgtgcctcgaccgcataggccagttcacctgcatctgtatggcaggcttcaca
ggcacctattgtgaagtggacatggatgagtgtcagagcagcccatgtgtcaatggcgga
atctgcaaggacagagtcaatggcttcagctgcacttgcccctcaggcttcagcggggcc
atgtgtcagctggatgttgatgagtgcgccagcacaccctgccggaatggagccaaatgt
gtggaccagcccgatggctacgagtgccgctgcgcagagggcttcgagggcacattgtgt
gaactcaacgttgatgattgctccccggacccgtgccaccacggtcgctgcgtggacggc
atcgccagtttctcctgtgcctgtgccccgggctacacgggcacgcgctgtgagagtcag
gtcgatgagtgccgcagccagccctgccgccatggcggcaaatgcctagacctggtggat
aaatacctctgccgctgccttcctggcaccacaggtgtgagctgcgaggtgaacatagat
gattgtgccagcaacccctgcacttttggaatctgccgagatggtatcaaccgctacgac
tgtgtctgccagcctggcttcacagggcccctttgcaacgtggagatcaacgaatgtgca
tccagcccgtgcggcgagggaggctcctgcgtggatggggaaaacggcttccgctgcctc
tgcccacctggctccttgcccccactgtgccttcccccgagccatccctgtgcccaagaa
ccctgcagtcacggtgtctgccacgatgcacctggagggttccgctgtgagtgtgagcct
ggctggagtggcccccagtgcagccagagccttgctcaagatgcctgtgagtctcagccc
tgtggggctggtggcacctgcaccagcgatggaatgggcttccactgcatctgtccccct
ggtgtccatggtcatcagtgtgagctgctgtccccctgcaccccaaacccttgcgagcat
ggaggccactgtgagtctgctcctggccagctggctatctgctcctgcccccctggctgg
caaggcctgagatgccagcaggatgtagacgagtgtgccagcccctcaccctgtggatcc
catggtacctgcaccaacctggcagggagttttagctgtacctgcctcagagggtacagt
ggcccttcctgtgaccaggacatcaatgactgtgatcccaacccctgcctgaatggtggc
tcctgtcaggatcatgtgggctccttttcctgctcctgcctccctggctttgctggcccc
cgctgtgcccgcgatgtggatgagtgtctgagcagcccctgcggcccaggcacctgcact
gaccacgtggcctccttcacctgcacctgccctccaggctatggaggcttccgttgcgag
caggacctacccaactgcagccccagctcctgcttcaatggtgggacctgcgtggatggc
gtgaactcattcagctgcctgtgccgccctggctacactggtgcacactgccagcacgag
gccgacccctgcctctcgcggccctgtctgcacgggggcgtctgcactgccacccactcc
ggcttccgctgtgcctgtcccgagggcttcactggcactcagtgccagacgctggtagac
tggtgcagccgtgcgccctgtcagaatgggggtcgctgtgcccggacaggaacctctttc
tactgcctttgtcctccagggtggagcggcagcctctgtgacatccagagcctgccctgc
agagaggctgcagcccagatgggggtgcggatggagcagctgtgtcaggctggtgggcac
tgtgtggacaaggacagctcccactactgcgtgtgcccagagggccgcacaggcagccac
tgtgagcaggagatggatccctgcttggctcggccctgccagcatgggggcacctgccga
ggctacatgggaggttatgtgtgtgagtgtccagctggctatgctggtgacaactgtgag
gatgacgtggatgagtgtgcctcccagccctgccagcatgggggcttctgcattgacctt
gtggcccgatatctctgctcctgccccgctgggacgctgggtgtgctctgtgagattaat
gaggatgactgtggcccaggtctacccctggacctacacccccagtgcctgcacaatggt
acctgtgtagacctggtgggtggcttccgctgtacctgccccccaggatacactggcctg
cgctgtgaggcagacatcaatgagtgtcacccgggtgcctgccatgcagcacacacccgg
gactgcctgcaggagccaggtgggggcttccgctgcctttgtcaagccggctttacaggt
gcccgctgtcagactatgctgtctccttgcgagtcccagccatgccagcatggcggccag
tgccttcccagtcaaggccctgggggtgctctgacctttgcttgccattgcatcccgcct
ttctcgggctcacgttgcgagcgggtggcgcgctcctgccgggagctgcagtgtccggtt
ggcgtcccgtgccagctgacggtccgtgggccacgctgtgcctgccctccgggactgtcg
gggcctgcctgcagaggctcccgggagtcgccgccgggggccaccaacgccagctgcgtg
gcctccccctgcctccatgggggctcttgccgccccgaaccgttggcacccttcttccgc
tgcgcgtgcgtgccaggctgggctggacagcgctgcgaggtgccggccgcggcccccgag
gcccccgaggagcctctgtgcccgagcgccgcctgcgaggccaagagtggggacaagcgc
tgcgaccgcgagtgcaacagcccgggttgcggctgggatggcggtgactgctcgctgagc
gtgggcgacccctggcggcagtgctcagcgctgcagtgctggcgcctcttcaacaacagc
cgctgtgaccccgcctgtagctctcccgcctgcctctacgacaacttcgactgtcgggct
ggcggccgcgagcgtgcttgcaacccggtgtacgagaagtactgcgcggaccactttgcg
gatggccgctgtgaccagggctgtaacacagaggagtgcggctgggacgggctggactgt
gctggcgaggtgccggccctgttagcccgcggtgtgctggtgctcacggtgctgctgccg
cccgaggagctgctgcgctccagcgccgacttcttgcagcggctcagcggcatcctacga
acctcgctgcgcttccgcctggacgagcatggccaggccatggtcttcccttaccaccgg
ccaggccctggctctgaagcccggaaccggagagagctggccccagaggtgatcggctca
gtggtgatgctggagattgacaaccggctgtgcctacagtcaccagagaacaaccactgc
ttccctgacgcccagagcgcggccgactacctaggagcactgtcagcagtggagcgcttg
gacttcccgtaccctctgcgggccgcgcggggggagccgctggagctgccagagccaagc
gtgccgctgctgccactgctggctgccagtgccgtcttcctgctggtcatccttgtcctg
ggtgtcatggtggcccggcgcaagcgtgagcacagcaccctgtggttccctgagggcttt
gttctgcacaaggacatggctactggacataagggccggcgggagcctgtgggccaagac
gcgctgggcatgaagaacatggccaagggtgagagtctgatgggggaggtggccacagac
tggatggacacggagtgcccggaggccaagcgactaaaggtagaggagcccagcgtgggg
gccgaggacactgtggattgccgccagtggactcagcaccatctggttgccgctgatatc
cgtgtggcaccagccatggcattgacaccaccacagggtgatgcggatgccgatggcatg
gatgtcaatgtgcgtggcccagatggcttcaccccgctgatgctggcctccttctgtggg
gggaccctggagccgatgccgactgaagaggatgaggcagaagacacatcagccagcatc
atctcagacctgatctgtcagggggcccagctcggggcacggactgaccgcacaggcgag
acggccctgcacctggctgcccggtatgcccgggctgacgctgccaagaggctgctggat
gctggggcagacaccaatgcccaggaccactcgggccgaactcccctgcacacagctgtc
actgctgacgcccagggcgtcttccagattctcatccggaaccgctccacagacctggat
gcccgcatggcagatggctcaacggcattgatcctggcggctcgcctggctgtggagggc
atggtggaagagctcattgccagccacgctgatgtgaatgctgtggacgagctcgggaaa
tcagccttacactgggctgctgctgtcaacaacgtggaggctaccttggccctgctcaaa
aatggagccaacaaggacatgcaggatagcaaggaggagactcccctgttcctggctgcc
cgggagggcagctacgaggctgccaagctgctgctggaccattttgccaaccgtgagatc
actgaccacctggacaggctgccacgtgatgtggctcaggagaggctgcaccaggacatt
gtgggcctgctggaccagcccagtgggccccgtagtccccctggcccccacggtctgggg
cccctgctctgcccacctggggcctttctcccaggcctcaaggcggcacagtcagggggc
aagaagagccggaggctaccagggaagaccgggctggggccacagggcacccggggccgg
ggcaagaagctgacactggcctgcccaggccccctggctgaaagctcggtcacactgtca
cctgtggactcgctggactccccgaggcccttcggtggcccccctgcctctcctggaggc
ttctccctagaagggccctatgtgggtgccaccaccacggctgtgtccctggcacaactt
ggtggtgcaggccgggcaggtctagggcgccagcccaccgggggctgcgtccttagccta
ggcttgctgaaccctgtggccgttccccttgactgggcccggctgcccccacctgccccg
ccaggcccttcattcctgctgccgctggcaccgggaccccagctgctgaaccctgggacc
cctgtgtccccccaggagcggcccccgccatacctggcagtcccaggacatggcgaggag
tacccggcagctggggcccatggcagccccgctaaggcccgcttcctgcgggtccccagc
gagcatccctacctgaccccatcccctgagtcccctgagcactgggccagcccctcacct
ccctcactgtctgactggtccgactctacacccagcccagccactgccactggggccaca
gctacagctgctgggacactgcctgctcagccactccccctgtctgtccctggccccttg
gttcaggcccagacccagctgggaccgcagcctgaagccacccccaagaggcaggtgttg
gcctga

DBGET integrated database retrieval system