KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498469
Entry
107498469         CDS       T06036                                 

Gene name
HSPA1A
Definition
(RefSeq) heat shock 70 kDa protein 1A
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03040  Spliceosome
ray04010  MAPK signaling pathway
ray04141  Protein processing in endoplasmic reticulum
ray04144  Endocytosis
ray04213  Longevity regulating pathway - multiple species
ray04612  Antigen processing and presentation
ray04915  Estrogen signaling pathway
ray05020  Prion disease
ray05134  Legionellosis
ray05145  Toxoplasmosis
ray05162  Measles
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107498469 (HSPA1A)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107498469 (HSPA1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107498469 (HSPA1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107498469 (HSPA1A)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107498469 (HSPA1A)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107498469 (HSPA1A)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107498469 (HSPA1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107498469 (HSPA1A)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107498469 (HSPA1A)
  09172 Infectious disease: viral
   05162 Measles
    107498469 (HSPA1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107498469 (HSPA1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107498469 (HSPA1A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ray03041]
    107498469 (HSPA1A)
   03009 Ribosome biogenesis [BR:ray03009]
    107498469 (HSPA1A)
   03110 Chaperones and folding catalysts [BR:ray03110]
    107498469 (HSPA1A)
   04131 Membrane trafficking [BR:ray04131]
    107498469 (HSPA1A)
   03051 Proteasome [BR:ray03051]
    107498469 (HSPA1A)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107498469 (HSPA1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107498469 (HSPA1A)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107498469 (HSPA1A)
Spliceosome [BR:ray03041]
 Complex B
  Other components
   Prp19 complex
    107498469 (HSPA1A)
 Complex C
   Prp19-CDC5 complex
    107498469 (HSPA1A)
Ribosome biogenesis [BR:ray03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107498469 (HSPA1A)
Chaperones and folding catalysts [BR:ray03110]
 Heat shock proteins
  HSP70 / DNAK
   107498469 (HSPA1A)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107498469 (HSPA1A)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107498469 (HSPA1A)
Proteasome [BR:ray03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107498469 (HSPA1A)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107498469 (HSPA1A)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107498469 (HSPA1A)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Hydantoinase_A Radial_spoke_3
Other DBs
NCBI-GeneID: 107498469
NCBI-ProteinID: XP_015977121
LinkDB
Position
Unknown
AA seq 641 aa
MAKTTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVISDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRGTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISESDKKKVLDKCQEVISWLDANSLAEKEEFEHKRKELE
QVCNPIISGLYQGAGGPGAGGFGAQAPKGGSGSGPTIEEVD
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggctaaaaccacagccatcggcatcgacctgggcaccacctactcgtgcgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacccccagc
tacgtggcgttcaccgacaccgagcggctcatcggggatgccgccaagaaccaggtggcg
ctgaacccgcagaacaccgtgttcgacgccaagcggctgatcggccgcaagttcggcgac
gcggtggtgcagtcggacatgaagcactggcctttccaggtgatcagcgacggggacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcgttctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcaggggtgatcgcggggctgaacgtgctgaggatcatcaacgagcccacggccgccgcc
atcgcctacggcctagacaggaccggcaagggggagcgcaacgtgctcatcttcgacctg
ggcgggggcaccttcgacgtgtcgatcctgaccatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacctgggaggggaagactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgttcgagggcatcgacttctacacgtccatcaccagggcg
cggttcgaggagctgtgctccgacctgtttcggggcaccctggagccagtggagaaggct
ctgcgtgacgccaagctggacaaggcccagatccacgacctggtcctggtggggggctcc
acccgcatccccaaggtgcagaagctgctgcaggactttttcaacgggcgcgacctcaac
aagagcatcaaccccgatgaggcggtggcttacggggcggcggtgcaggcagccatcctg
atgggggacaagtccgagaatgtgcaggacctgctgctgctggacgtggctcctctgtcg
ctggggctggagactgccgggggcgtgatgaccgccctgatcaagcgcaactccaccatc
cccaccaagcagacgcagaccttcaccacctactcggacaaccagcccggggtgctgatc
caggtgtacgagggcgagagggccatgacgaaggacaacaacctgctggggcgcttcgag
ctgagcggcatcccacctgcccccaggggcgtgccccagatcgaggtgacctttgatatc
gacgccaatggcatcctgaacgtcacggctacggacaagagcaccggcaaggccaacaag
atcaccatcaccaatgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaagcggagaagtacaaagccgaggacgaggtccagcgcgagagggtgtctgccaagaac
gctttggagtcgtacgccttcaacatgaagagcgctgtggaggatgaggggctcaaaggc
aagatcagcgagtccgacaagaagaaggtgctagacaagtgccaggaggtgatttcctgg
ctggacgccaacagcctggccgagaaggaggagtttgagcacaagaggaaggagttggag
caggtgtgtaaccccatcatcagcggactgtaccagggggcgggcggccccggggccggt
gggtttggggcccaggcccccaaggggggctctgggtctggcccgaccattgaggaggtg
gattag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498470
Entry
107498470         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03040  Spliceosome
ray04010  MAPK signaling pathway
ray04141  Protein processing in endoplasmic reticulum
ray04144  Endocytosis
ray04213  Longevity regulating pathway - multiple species
ray04612  Antigen processing and presentation
ray04915  Estrogen signaling pathway
ray05020  Prion disease
ray05134  Legionellosis
ray05145  Toxoplasmosis
ray05162  Measles
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107498470
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107498470
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107498470
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107498470
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107498470
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107498470
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107498470
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107498470
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107498470
  09172 Infectious disease: viral
   05162 Measles
    107498470
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107498470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107498470
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ray03041]
    107498470
   03009 Ribosome biogenesis [BR:ray03009]
    107498470
   03110 Chaperones and folding catalysts [BR:ray03110]
    107498470
   04131 Membrane trafficking [BR:ray04131]
    107498470
   03051 Proteasome [BR:ray03051]
    107498470
   03029 Mitochondrial biogenesis [BR:ray03029]
    107498470
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107498470
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107498470
Spliceosome [BR:ray03041]
 Complex B
  Other components
   Prp19 complex
    107498470
 Complex C
   Prp19-CDC5 complex
    107498470
Ribosome biogenesis [BR:ray03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107498470
Chaperones and folding catalysts [BR:ray03110]
 Heat shock proteins
  HSP70 / DNAK
   107498470
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107498470
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107498470
Proteasome [BR:ray03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107498470
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107498470
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107498470
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3 Hydantoinase_A
Other DBs
NCBI-GeneID: 107498470
NCBI-ProteinID: XP_015977122
LinkDB
Position
Unknown
AA seq 719 aa
MQSRAPRGKQRACRDKLIDEVLTGVAERASTDPLPPRTNPCGTGLQFPASERTELLSRIP
AAVFRPEPQRGAREQGTGMAKTTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYV
AFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDAVVQSDMKHWPFQVISDGDKPK
VQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAG
VIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKAT
AGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASL
EIDSLFEGIDFYTSITRARFEELCSDLFRGTLEPVEKALRDAKLDKAQIHDLVLVGGSTR
IPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLG
LETAGGXMTALIKRNSTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELS
GIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEA
EKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISESDKKKVLDKCQEVISWLD
ANSLAEKEEFEHKRKELEQVCNPIISGLYQGAGGPGAGGFGAQAPKGGSGSGPTIEEVD
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgcagagccgcgcgccgcggggaaaacagcgagcctgcagagacaagctgattgacgaa
gtgctgacgggtgtcgctgagcgcgcttccaccgacccactgcctccgaggacgaacccc
tgcggcaccggccttcagttcccggcttcggaaaggaccgagcttctgtcgcggatcccg
gccgccgttttcaggcccgaacctcagcgcggggcgagagagcagggcaccggcatggct
aaaaccacagccatcggcatcgacctgggcaccacctactcgtgcgtgggggtgttccag
cacggcaaggtggagatcatcgccaacgaccagggcaaccgcacgacccccagctacgtg
gcgttcaccgacaccgagcggctcatcggggatgccgccaagaaccaggtggcgctgaac
ccgcagaacaccgtgttcgacgccaagcggctgatcggccgcaagttcggcgacgcggtg
gtgcagtcggacatgaagcactggcctttccaggtgatcagcgacggggacaagcccaag
gtgcaggtgagctacaagggggagaccaaggcgttctaccccgaggagatctcgtccatg
gtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgaccaacgcg
gtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggatgcaggg
gtgatcgcggggctgaacgtgctgaggatcatcaacgagcccacggccgccgccatcgcc
tacggcctagacaggaccggcaagggggagcgcaacgtgctcatcttcgacctgggcggg
ggcaccttcgacgtgtcgatcctgaccatcgacgacggcatcttcgaggtgaaggccacg
gccggggacacccacctgggaggggaagattttgacaacaggctggtgaaccacttcgtg
gaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgagccgtgaggcgg
ctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacccaggccagcctg
gagatcgactccctgttcgagggcatcgacttctacacgtccatcaccagggcgcggttc
gaggagctgtgctccgacctgtttcggggcaccctggagccagtggagaaggctctgcgt
gacgccaagctggacaaggcccagatccacgacctggtcctggtggggggctccacccgc
atccccaaggtgcagaagctgctgcaggactttttcaacgggcgcgacctcaacaagagc
atcaaccccgatgaggcggtggcttacggggcggcggtgcaggcagccatcctgatgggg
gacaagtccgagaatgtgcaggacctgctgctgctggacgtggctcctctgtcgctgggg
ctggagactgccgggggtnngatgaccgccctgatcaagcgcaactccaccatccccacc
aagcagacgcagaccttcaccacctactcggacaaccagcccggggtgctgatccaggtg
tacgagggcgagagggccatgacgaaggacaacaacctgctggggcgcttcgagctgagc
ggcatcccacctgcccccaggggcgtgccccagatcgaggtgacctttgatatcgacgcc
aatggcatcctgaacgtcacggctacggacaagagcaccggcaaggccaacaagatcacc
atcaccaatgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcaggaagcg
gagaagtacaaagccgaggacgaggtccagcgcgagagggtgtctgccaagaacgctttg
gagtcgtacgccttcaacatgaagagcgctgtggaggatgaggggctcaaaggcaagatc
agcgagtccgacaagaagaaggtgctagacaagtgccaggaggtgatttcctggctggac
gccaacagcctggccgagaaggaggagtttgagcacaagaggaaggagttggagcaggtg
tgtaaccccatcatcagcggactgtaccagggggcgggcggccccggggccggtgggttt
ggggcccaggcccccaaggggggctctgggtctggcccgaccattgaggaggtggattag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498471
Entry
107498471         CDS       T06036                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like isoform X1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03040  Spliceosome
ray04010  MAPK signaling pathway
ray04141  Protein processing in endoplasmic reticulum
ray04144  Endocytosis
ray04213  Longevity regulating pathway - multiple species
ray04612  Antigen processing and presentation
ray04915  Estrogen signaling pathway
ray05020  Prion disease
ray05134  Legionellosis
ray05145  Toxoplasmosis
ray05162  Measles
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107498471
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107498471
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107498471
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107498471
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107498471
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107498471
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107498471
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107498471
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107498471
  09172 Infectious disease: viral
   05162 Measles
    107498471
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107498471
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107498471
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ray03041]
    107498471
   03009 Ribosome biogenesis [BR:ray03009]
    107498471
   03110 Chaperones and folding catalysts [BR:ray03110]
    107498471
   04131 Membrane trafficking [BR:ray04131]
    107498471
   03051 Proteasome [BR:ray03051]
    107498471
   03029 Mitochondrial biogenesis [BR:ray03029]
    107498471
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107498471
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107498471
Spliceosome [BR:ray03041]
 Complex B
  Other components
   Prp19 complex
    107498471
 Complex C
   Prp19-CDC5 complex
    107498471
Ribosome biogenesis [BR:ray03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107498471
Chaperones and folding catalysts [BR:ray03110]
 Heat shock proteins
  HSP70 / DNAK
   107498471
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107498471
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107498471
Proteasome [BR:ray03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107498471
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107498471
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107498471
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3 Hydantoinase_A
Other DBs
NCBI-GeneID: 107498471
NCBI-ProteinID: XP_015977123
LinkDB
Position
Unknown
AA seq 671 aa
MSVLGVSHQLPAQKNSRTFRAQRETRPRKSMAATKGMAIGIDLGTTYSCVGVFQHGKVEI
IANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQSDMK
LWPFQVINEGGKPKVLVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHPVTNAVITVPA
YFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKAGQGERHVLIFDLGGGTFDVS
ILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACE
RAKRTLSSSTQANLEIDSLFEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDK
AKIHDIVLVGGSTRIPKVQRLLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKV
QDLLLLDVAPLSLGLETAGGVMTVLIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERA
MTRDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAMDKSTGKANKITITNDKG
RLSKEEIERMVVDAEKYKAEDEVQREKIAAKNALESYAFNMKSAVSDEGLKGKISETDKK
KILDKCNEVLSWLEANQLAEKDEFDHKRKELEQVCNPVVTKLYQGGCTGPACGTGTMPGR
AATGPTIEEVD
NT seq 2016 nt   +upstreamnt  +downstreamnt
atgagtgttctaggagtcagtcaccaacttccagcccaaaaaaactccagaacgttccgg
gcacaacgcgaaacaaggcctcggaaaagcatggctgctactaagggaatggccattggc
atcgacctgggcaccacctactcatgtgtgggggtgttccagcatggcaaggtggagatc
atcgccaacgaccagggcaaccgcaccacccctagctacgtggccttcaccgatactgag
cggctcatcggggatgccgccaagaaccaggtagccatgaatccccagaacactgtcttt
gatgccaaacgtctgattggcagaaaatttaatgatcctgtagtacaatcagatatgaaa
ctttggccttttcaagtaatcaatgaaggaggcaagcctaaggtgctggtgtcctacaaa
ggggagaaaaaagctttctaccctgaagaaatctcttctatggtactaactaaaatgaag
gagactgctgaggcttttttaggccaccctgtcaccaatgctgtgatcactgtgccagcc
tatttcaatgactctcaacgccaggccaccaaggatgcaggtgtgattgcaggtctcaat
gtgttaagaattatcaatgaacccacagctgctgccattgcctatggcttagataaagca
ggtcagggagagcgacatgtactgatctttgatctgggtggaggcacatttgatgtgtcc
atcctgaccatagatgatgggatttttgaggtaaaggccacagctggggacacccacttg
ggtggagaggactttgacaacagactggtgagtcactttgtggaagagttcaagaggaag
cacaagaaggacatcagccaaaacaagcgagctgtgaggcggctgcgaactgcctgtgag
agggccaagaggaccctgtcatccagcactcaggccaacttggaaatcgattcacttttt
gaaggaattgacttctacacgtccattaccagagcccggtttgaggagttgtgtgcagat
ctgttcaggggcactctggagcctgtggagaaggctcttcgtgatgccaagatggataaa
gctaaaattcatgacattgttttagtaggaggctctacccgcatccctaaggttcagagg
ctgctgcaggactactttaatggccgtgatctcaacaagagcatcaacccagatgaggca
gtggcctatggggctgcagtacaggcagccattttgatgggggacaagtccgaaaaggta
caggacctgcttttgttagatgtggctcccttgtccttagggttggagacagccgggggt
gtgatgacggtcctaattaagcgcaactccaccatccccaccaagcagacacagatcttc
accacttactcagataaccagcctggggtattgatccaggtgtatgagggcgagagggcc
atgacgagggacaacaatctgctggggcgctttgacctgactggaatccctcctgcacct
agaggagttcctcagatcgaagtaacctttgacatcgatgccaacggtattctcaatgta
acggccatggacaagagcacaggaaaggccaacaagatcaccatcaccaatgacaagggc
cgcctgagcaaggaggagattgagcgcatggttgtggatgctgaaaaatacaaagccgaa
gatgaggtccagagagagaaaattgctgcaaaaaatgccttagaatcttatgcttttaac
atgaagagtgctgtgagtgatgaaggcttgaagggtaagattagtgagacggataaaaag
aaaatactggataaatgcaatgaggtcctttcatggctggaggccaatcaactggcagaa
aaagatgaatttgatcataagagaaaggaattggaacaagtgtgcaacccagtcgtcaca
aaactctaccagggagggtgcactgggcctgcctgtggaacagggactatgcctggaagg
gctgcgacaggccccaccattgaagaagtagattaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503644
Entry
107503644         CDS       T06036                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03040  Spliceosome
ray04010  MAPK signaling pathway
ray04141  Protein processing in endoplasmic reticulum
ray04144  Endocytosis
ray04213  Longevity regulating pathway - multiple species
ray04612  Antigen processing and presentation
ray04915  Estrogen signaling pathway
ray05020  Prion disease
ray05134  Legionellosis
ray05145  Toxoplasmosis
ray05162  Measles
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107503644 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107503644 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107503644 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107503644 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107503644 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107503644 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107503644 (HSPA8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107503644 (HSPA8)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107503644 (HSPA8)
  09172 Infectious disease: viral
   05162 Measles
    107503644 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107503644 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107503644 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ray03041]
    107503644 (HSPA8)
   03009 Ribosome biogenesis [BR:ray03009]
    107503644 (HSPA8)
   03110 Chaperones and folding catalysts [BR:ray03110]
    107503644 (HSPA8)
   04131 Membrane trafficking [BR:ray04131]
    107503644 (HSPA8)
   03051 Proteasome [BR:ray03051]
    107503644 (HSPA8)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107503644 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107503644 (HSPA8)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107503644 (HSPA8)
Spliceosome [BR:ray03041]
 Complex B
  Other components
   Prp19 complex
    107503644 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    107503644 (HSPA8)
Ribosome biogenesis [BR:ray03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107503644 (HSPA8)
Chaperones and folding catalysts [BR:ray03110]
 Heat shock proteins
  HSP70 / DNAK
   107503644 (HSPA8)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107503644 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107503644 (HSPA8)
Proteasome [BR:ray03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107503644 (HSPA8)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107503644 (HSPA8)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107503644 (HSPA8)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Other DBs
NCBI-GeneID: 107503644
NCBI-ProteinID: XP_015987719
LinkDB
Position
Unknown
AA seq 646 aa
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgtctaagggacctgcagttggcattgatcttggcaccacctactcctgtgtgggtgtc
ttccagcacggaaaagtggaaataattgccaacgaccagggaaaccgaactactccaagt
tacgtggcttttactgatacggagcgattgatcggtgatgctgcaaagaatcaagttgca
atgaaccccaccaacacggtttttgatgccaaacgcctgattggacgaagatttgatgat
gctgttgtccaatccgatatgaagcattggcccttcatggtggtgaatgatgctggcagg
cccaaagtccaagtagaatacaaaggagagacaaaaagtttctatccagaggaggtgtca
tctatggttttgacaaagatgaaggaaattgcagaagcctaccttgggaagactgttaca
aatgctgtggtcacagtacctgcttatttcaatgactctcagcggcaggctaccaaagat
gctggaactattgctggtctcaatgtacttagaattatcaatgaaccaactgctgctgct
attgcttatggcttagataaaaaggttggagctgaaagaaatgtgctgatctttgacttg
ggaggtggcacttttgatgtgtcgattctcacaattgaagatggaattttcgaagtgaaa
tctacagctggggacacccacttaggtggagaagactttgacaaccgaatggtcaaccat
tttattgcagagtttaagcgcaagcataagaaggacatcagtgagaacaaaagggctgtc
agacgtctccgcactgcttgtgaacgtgctaagcgtaccctttcttccagtacccaggcc
agtattgagattgattcgctctatgaaggaatcgacttctatacctctatcactcgtgcc
cgatttgaagaattgaatgctgaccttttccgtggcaccctggaccctgtagaaaaagcc
cttcgggatgcgaagctcgacaagtcccagatccatgatattgtcctggtgggtggttct
acccgtatccctaagattcagaaacttctacaggacttcttcaatggaaaagaattgaat
aagagcatcaaccctgatgaagctgtcgcttatggtgcagctgtccaggcagccatccta
tccggagataaatctgaaaatgttcaagatttgctgctgttggatgtcactcctctttct
cttggcattgaaactgctggcggagtcatgactgtcctcattaagcgcaatactaccatt
cctaccaagcagacacagaccttcactacctactctgataaccagcctggtgtactcatt
caggtttacgaaggtgagcgggccatgaccaaggataacaacctgcttggcaagtttgag
ctcacaggcatacctcctgctcctcgtggtgttcctcagattgaagtcacttttgatatc
gatgctaatggtatacttaatgtctctgctgtggataagagcacgggaaaagagaacaag
attactatcactaatgacaagggtcgtctcagcaaggaagacatcgagcgcatggtccaa
gaagctgagaaatacaaggctgaagatgagaagcagcgggataaggtgtcttcgaagaac
tcactcgaatcttatgcattcaacatgaaagcaactgttgaagatgaaaaacttcaaggc
aagatcaacgatgaggacaaacagaagattcttgataagtgcaatgaaatcatcaactgg
cttgataagaaccagactgcagagaaggaagaatttgaacatcagcagaaagagctggaa
aaagtatgcaaccccatcattaccaagctgtaccagagtgcaggaggcatgcctggagga
atgcctgggggcttccctggtggtggagctcctccttctggtggtgcctcttctggccct
accattgaagaggttgattaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509320
Entry
107509320         CDS       T06036                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock-related 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03040  Spliceosome
ray04010  MAPK signaling pathway
ray04141  Protein processing in endoplasmic reticulum
ray04144  Endocytosis
ray04213  Longevity regulating pathway - multiple species
ray04612  Antigen processing and presentation
ray04915  Estrogen signaling pathway
ray05020  Prion disease
ray05134  Legionellosis
ray05145  Toxoplasmosis
ray05162  Measles
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107509320 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107509320 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107509320 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107509320 (HSPA2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107509320 (HSPA2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107509320 (HSPA2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    107509320 (HSPA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107509320 (HSPA2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107509320 (HSPA2)
  09172 Infectious disease: viral
   05162 Measles
    107509320 (HSPA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107509320 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107509320 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ray03041]
    107509320 (HSPA2)
   03009 Ribosome biogenesis [BR:ray03009]
    107509320 (HSPA2)
   03110 Chaperones and folding catalysts [BR:ray03110]
    107509320 (HSPA2)
   04131 Membrane trafficking [BR:ray04131]
    107509320 (HSPA2)
   03051 Proteasome [BR:ray03051]
    107509320 (HSPA2)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107509320 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107509320 (HSPA2)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107509320 (HSPA2)
Spliceosome [BR:ray03041]
 Complex B
  Other components
   Prp19 complex
    107509320 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    107509320 (HSPA2)
Ribosome biogenesis [BR:ray03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107509320 (HSPA2)
Chaperones and folding catalysts [BR:ray03110]
 Heat shock proteins
  HSP70 / DNAK
   107509320 (HSPA2)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107509320 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107509320 (HSPA2)
Proteasome [BR:ray03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107509320 (HSPA2)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107509320 (HSPA2)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107509320 (HSPA2)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DUF1464 Hydantoinase_A DDR CRIC_ras_sig
Other DBs
NCBI-GeneID: 107509320
NCBI-ProteinID: XP_015997236
LinkDB
Position
Unknown
AA seq 635 aa
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEIKTFFPEEI
SSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGGSGASGGPTIEEVD
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgtcagcccgcggcccggctatcggcatcgacctgggcaccacctactcgtgcgtgggg
gtcttccaacatgggaaggtggagatcattgccaacgaccagggcaaccgcaccaccccc
agctacgttgccttcactgacaccgagcgcctcatcggtgacgccgccaagaaccaggtg
gccatgaaccccaccaacaccatcttcgacgccaagaggctgatcggacggaagttcgag
gacgccacagtgcagtcggacatgaagcactggccgttccgggtggtgagcgagggaggg
aagcccaaagtgcaggtggagtacaagggagagatcaagaccttcttcccagaggagatc
tcctccatggtgctcactaaaatgaaggagatcgccgaagcctacctggggggcaaggtg
cagagcgcggtcatcaccgtccctgcctatttcaatgattcgcagcgccaggctacaaaa
gacgccggcaccatcacaggcctcaacgtgctgcgcatcatcaacgagcccacagcggcg
gccatcgcctacggcctggacaagaagggctgcgcgggcggcgagaagaacgtgctcatc
tttgacctgggcggcggcacctttgacgtgtccatcctgaccatcgaggacggcatcttc
gaggtgaagtccacagccggcgacacccacctgggcggcgaggacttcgacaaccgcatg
gtgagccacctggcggaggaattcaagcgcaagcacaagaaggacattgggcccaataag
cgcgcggtgcggcggcttcgcactgcctgcgagcgcgccaagcgcacccttagctcatcc
acacaagccagcatcgaaatcgactcgctctatgagggtgtggacttctacacgtccatc
acgcgcgcccgtttcgaggagctcaacgccgatctgttccgcggaactctggagccggtg
gagaaggcgctgcgcgacgccaagcttgacaagggccagatccaggagatcgtgctggtg
ggaggctccacccgcatccctaagatccagaagctgctgcaggatttcttcaacggcaag
gagctgaacaagagcatcaaccctgatgaggcggtggcctacggagccgcggtgcaggcg
gccatcctcatcggggacaagtcagagaacgtgcaggacctcctgctgctcgatgtcacc
ccgttgtcgctcggcattgagacggctggaggcgtcatgaccccactcatcaagaggaac
accacaatccccaccaagcagacgcagaccttcaccacctactcggacaaccagagcagc
gtgctggtgcaggtgtacgagggcgaacgggccatgaccaaggacaataacctgttgggc
aagttcgacctgaccgggattcccccggcaccccgcggggtcccgcagatcgaggtcacc
ttcgacatcgacgccaacggcatcctcaatgtcaccgccgccgacaagagcaccggtaaa
gaaaacaaaattaccatcaccaatgacaagggtcgtctgagcaaggacgacattgatcgg
atggtgcaggaggcggagcggtacaaatcggaagatgaagccaatcgcgatcgtgtcgcc
gccaaaaatgccgtggagtcttatacctacaacatcaagcagacggtggaagacgagaaa
ctgaggggcaagattagtgagcaggacaaaaacaagatcctcgacaagtgccaggaggtg
atcaactggctcgaccgaaaccagatggcagagaaagatgagtatgaacacaagcagaaa
gagctggaaagagtgtgcaaccccatcatcagcaaactttaccaaggcggcccgggcggc
ggcgggtctggagcctccgggggacccaccatcgaggaagtggactaa

DBGET integrated database retrieval system