KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498497
Entry
107498497         CDS       T06036                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01523  Antifolate resistance
ray04010  MAPK signaling pathway
ray04060  Cytokine-cytokine receptor interaction
ray04061  Viral protein interaction with cytokine and cytokine receptor
ray04064  NF-kappa B signaling pathway
ray04071  Sphingolipid signaling pathway
ray04150  mTOR signaling pathway
ray04210  Apoptosis
ray04217  Necroptosis
ray04350  TGF-beta signaling pathway
ray04380  Osteoclast differentiation
ray04612  Antigen processing and presentation
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04640  Hematopoietic cell lineage
ray04650  Natural killer cell mediated cytotoxicity
ray04657  IL-17 signaling pathway
ray04660  T cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04668  TNF signaling pathway
ray04920  Adipocytokine signaling pathway
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04940  Type I diabetes mellitus
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05133  Pertussis
ray05134  Legionellosis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05143  African trypanosomiasis
ray05144  Malaria
ray05145  Toxoplasmosis
ray05146  Amoebiasis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05205  Proteoglycans in cancer
ray05310  Asthma
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107498497 (TNF)
   04350 TGF-beta signaling pathway
    107498497 (TNF)
   04064 NF-kappa B signaling pathway
    107498497 (TNF)
   04668 TNF signaling pathway
    107498497 (TNF)
   04071 Sphingolipid signaling pathway
    107498497 (TNF)
   04150 mTOR signaling pathway
    107498497 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107498497 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107498497 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107498497 (TNF)
   04217 Necroptosis
    107498497 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107498497 (TNF)
   04620 Toll-like receptor signaling pathway
    107498497 (TNF)
   04621 NOD-like receptor signaling pathway
    107498497 (TNF)
   04622 RIG-I-like receptor signaling pathway
    107498497 (TNF)
   04625 C-type lectin receptor signaling pathway
    107498497 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    107498497 (TNF)
   04612 Antigen processing and presentation
    107498497 (TNF)
   04660 T cell receptor signaling pathway
    107498497 (TNF)
   04657 IL-17 signaling pathway
    107498497 (TNF)
   04664 Fc epsilon RI signaling pathway
    107498497 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107498497 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107498497 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107498497 (TNF)
  09163 Immune disease
   05310 Asthma
    107498497 (TNF)
   05322 Systemic lupus erythematosus
    107498497 (TNF)
   05323 Rheumatoid arthritis
    107498497 (TNF)
   05321 Inflammatory bowel disease
    107498497 (TNF)
   05330 Allograft rejection
    107498497 (TNF)
   05332 Graft-versus-host disease
    107498497 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107498497 (TNF)
   05014 Amyotrophic lateral sclerosis
    107498497 (TNF)
   05020 Prion disease
    107498497 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    107498497 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107498497 (TNF)
   05410 Hypertrophic cardiomyopathy
    107498497 (TNF)
   05414 Dilated cardiomyopathy
    107498497 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107498497 (TNF)
   04940 Type I diabetes mellitus
    107498497 (TNF)
   04932 Non-alcoholic fatty liver disease
    107498497 (TNF)
   04931 Insulin resistance
    107498497 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107498497 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107498497 (TNF)
   05135 Yersinia infection
    107498497 (TNF)
   05133 Pertussis
    107498497 (TNF)
   05134 Legionellosis
    107498497 (TNF)
   05152 Tuberculosis
    107498497 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498497 (TNF)
   05170 Human immunodeficiency virus 1 infection
    107498497 (TNF)
   05161 Hepatitis B
    107498497 (TNF)
   05160 Hepatitis C
    107498497 (TNF)
   05171 Coronavirus disease - COVID-19
    107498497 (TNF)
   05164 Influenza A
    107498497 (TNF)
   05168 Herpes simplex virus 1 infection
    107498497 (TNF)
   05163 Human cytomegalovirus infection
    107498497 (TNF)
   05169 Epstein-Barr virus infection
    107498497 (TNF)
   05165 Human papillomavirus infection
    107498497 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107498497 (TNF)
   05144 Malaria
    107498497 (TNF)
   05145 Toxoplasmosis
    107498497 (TNF)
   05140 Leishmaniasis
    107498497 (TNF)
   05142 Chagas disease
    107498497 (TNF)
   05143 African trypanosomiasis
    107498497 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107498497 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107498497 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107498497 (TNF)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Tumor necrosis fators
   107498497 (TNF)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Cytokines
   107498497 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 107498497
NCBI-ProteinID: XP_015977185
LinkDB
Position
Unknown
AA seq 232 aa
MSTESMIRDVELAEELPKKAGGPQASRRCLCLSLFSFLLVAGATTLFCLLHFRVIGPQRE
EFPTGLPLINPLAQTLGLSSRTPSDKPVAHVVANPLAEGQLQWLSQRANALLANGMKLTD
NQLVVPLDGLYLIYSQVLFKGQGCPQTHVLLTHTISRFADSYQDKVNLLSAIKSPCQRET
QDGAGAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggatgtggagctggctgaggagctccccaagaaggca
gggggcccccaggcctccagacggtgcttgtgcctcagccttttttccttcctcctcgtg
gcaggagccaccacgctcttctgcctgctgcacttcagagtgatcggcccccagagggaa
gagttcccgactggcctcccactaatcaaccctctggcccagactcttggattatcttct
cgaaccccaagtgacaagcctgtcgcccacgttgtagcaaaccccctagctgagggacag
ctccagtggctgagccagcgtgccaatgctctcctggccaatggtatgaagctgacagac
aaccagctggtggtgccattagatgggctatacctcatctactcccaggtcctcttcaaa
ggtcaaggctgccctcaaacccatgtactcctcacccacaccatcagccgcttcgctgac
tcctaccaggacaaggtcaacctcctctctgccatcaagagcccttgccagagggaaacc
caagacggggctggggccaagccctggtatgagcccatctacctgggaggagtcttccag
ctagagaagggtgatcgactcagtgccgagatcaacctgcctgactatcttgactttgct
gagtctgggcaggtctactttgggatcattgccttgtga

DBGET integrated database retrieval system