KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498502
Entry
107498502         CDS       T06036                                 

Gene name
POMC
Definition
(RefSeq) pro-opiomelanocortin
  KO
K05228  proopiomelanocortin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04920  Adipocytokine signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04927  Cortisol synthesis and secretion
ray04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107498502 (POMC)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107498502 (POMC)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107498502 (POMC)
   04915 Estrogen signaling pathway
    107498502 (POMC)
   04916 Melanogenesis
    107498502 (POMC)
   04925 Aldosterone synthesis and secretion
    107498502 (POMC)
   04927 Cortisol synthesis and secretion
    107498502 (POMC)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107498502 (POMC)
SSDB
Motif
Pfam: ACTH_domain Op_neuropeptide NPP
Other DBs
NCBI-GeneID: 107498502
NCBI-ProteinID: XP_015977187
LinkDB
Position
Unknown
AA seq 259 aa
MPRSCCSRSGPLLLALLLQASLEVRGWCLESSQCQDLTTESNLLVRLPRACKPDLSAETP
VFPGNGEEQLLAENREVRHGPLRWDRFGRRNGSSGGAGPKRAEAAAAAAGDGGDGADAGP
REGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKRELAGERPALAPSPE
GPDEAAAARADLEYGLLAEAEAEAVAKKDEGPYRMEHFRWGSPPKDKRYGGFMTSEKSQT
PLVTLFKNAIIKNAHKKGQ
NT seq 780 nt   +upstreamnt  +downstreamnt
atgccgagatcgtgctgcagccgctcggggcccctgctgctggccttgctgcttcaggcc
tccctggaggtgcgtggctggtgcctggagagcagccagtgtcaggacctcaccacggaa
agtaacctgctggtacgcctgcctcgcgcctgcaagcccgacctgtcggcggagacgccc
gtgttccccggcaacggcgaggagcagctgctggccgagaaccgcgaagtacgtcatggg
ccacttcgctgggaccgcttcggccgccgcaatggcagcagcggcggcgcgggcccgaag
cgcgcggaggcggcggcggcggcggcaggcgatggcggcgacggcgccgacgcggggccc
cgcgagggcaagcgctcctactccatggagcacttccgctggggcaagccggtgggcaag
aagcggcgcccggtgaaggtgtaccccaacggcgccgaggacgagtcggccgaggccttc
ccgctcgagttcaagagggagctggcgggcgagcggcccgcgctggcgcccagccccgag
ggcccggacgaggccgccgccgcccgcgccgacctggagtacggcctgctggccgaggcc
gaggccgaggcggtggcgaagaaggacgaggggccctaccggatggagcacttccgctgg
ggcagcccgcccaaggacaagcgctacggcggcttcatgacctccgagaagagccagacg
cccttggtgacgctgttcaaaaacgccatcatcaagaacgcccacaagaagggccagtga

DBGET integrated database retrieval system