KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498506
Entry
107498506         CDS       T06036                                 

Gene name
ADCY3
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray01522  Endocrine resistance
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04114  Oocyte meiosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04727  GABAergic synapse
ray04740  Olfactory transduction
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04962  Vasopressin-regulated water reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05032  Morphine addiction
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107498506 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107498506 (ADCY3)
   04371 Apelin signaling pathway
    107498506 (ADCY3)
   04020 Calcium signaling pathway
    107498506 (ADCY3)
   04072 Phospholipase D signaling pathway
    107498506 (ADCY3)
   04024 cAMP signaling pathway
    107498506 (ADCY3)
   04022 cGMP-PKG signaling pathway
    107498506 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107498506 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107498506 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107498506 (ADCY3)
   04062 Chemokine signaling pathway
    107498506 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    107498506 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    107498506 (ADCY3)
   04912 GnRH signaling pathway
    107498506 (ADCY3)
   04913 Ovarian steroidogenesis
    107498506 (ADCY3)
   04915 Estrogen signaling pathway
    107498506 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    107498506 (ADCY3)
   04921 Oxytocin signaling pathway
    107498506 (ADCY3)
   04926 Relaxin signaling pathway
    107498506 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    107498506 (ADCY3)
   04918 Thyroid hormone synthesis
    107498506 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    107498506 (ADCY3)
   04916 Melanogenesis
    107498506 (ADCY3)
   04925 Aldosterone synthesis and secretion
    107498506 (ADCY3)
   04927 Cortisol synthesis and secretion
    107498506 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107498506 (ADCY3)
   04270 Vascular smooth muscle contraction
    107498506 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    107498506 (ADCY3)
   04971 Gastric acid secretion
    107498506 (ADCY3)
   04972 Pancreatic secretion
    107498506 (ADCY3)
   04976 Bile secretion
    107498506 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107498506 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107498506 (ADCY3)
   04727 GABAergic synapse
    107498506 (ADCY3)
   04725 Cholinergic synapse
    107498506 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    107498506 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    107498506 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    107498506 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    107498506 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    107498506 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107498506 (ADCY3)
   04714 Thermogenesis
    107498506 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498506 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    107498506 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107498506 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107498506 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498506 (ADCY3)
   05163 Human cytomegalovirus infection
    107498506 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107498506 (ADCY3)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107498506 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 107498506
NCBI-ProteinID: XP_015977196
LinkDB
Position
Unknown
AA seq 1146 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPERGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSRDQLAPLVAAGIWLLLDVI
LFVLCKKGLLPVRVTRKVVPYLLWLLITAQIFSYLGLNFAGAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVVISVVSCVVHTLVLGVTVAQQQQDGLKGMRLLREILASVFLYLGAIIVG
ITSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTLDCLKGFEFDVEPGDGGSRC
DYLDEKGIETYLVIASKPEVKKTAVQNGLNGSALPNGAPPSSQPSSPALIETKEPNGSVH
ASGSTSDEPEEQGAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERES
AQVVKKRNTFLLSMRFMEPEMETRYSVEKEKQSGAAFSCSCVVLLCAALAEMLIDPWLMT
NYVTFVVGEVLLLILTICSLAAIFPQAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMA
NVVDMLSCLQFYAGPSNGTAGTGVEDGCAANPEYYDDVAVLSLVATIMLVQVSHMVKLTL
MLLIAGAVAVVNIYAWRPIFDEYDRRRFQEHDFPVVALEKMQILSTAGLNGTDRLPLLPS
KYSMTAMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPE
HVARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISD
FDSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLAD
FALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTG
VMGNIQVVEDTQAILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPATFPNGSSVTLPH
QVVDNS
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgaccccgagtactcggccgagtactccgccgagtac
tccgtcagcctaccctctgacccggagcgcggggtgggccggacccatgaaatctctgtg
cggaactcggggtcctgcctctgcctgcctcgctttatgcggctgaccttcgtgcccgag
tccttggagaacctgtaccagacctatttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtcttcgcagccctcttcgactgctacgtggtggtcatgtgcgccgtggtcttc
tcccgcgaccagctggctcccctcgtggcggctgggatctggctgctgttggatgtcatc
ctcttcgtgctctgcaaaaaggggctgctcccggtccgggtcacccggaaagtggtgccc
tacctactgtggctgctgataacggcccagatcttctcctacttgggcctgaacttcgcc
ggcgcccacgcagccagcgacacggtgggctggcaggccttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtggtcatctctgtggtctcctgtgtggtg
cacacgctcgtcttgggggtcaccgtggcccagcagcagcaggatgggctgaaggggatg
cggttgctgagagagatcctggccagtgtctttctgtacctcggcgccatcatcgtgggc
atcacgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctc
tccatcctgcccaagcacgtggctgacgagatgctcaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccggcacgagaacgtcagcatc
ctgttcgcggacatcgtgggcttcacccagctgtcctctgcctgcagcgcacaggagctc
gtgaagctgctcaacgagctcttcgcccgtttcgacaagctggcggccaaatatcaccag
ctgaggatcaagatcctgggcgactgttactattgcatctgtggcctgcccgactaccgc
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgagagaagacgaagaccggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctgggcggcgtcctgggccagaagcgctggcagtacgacgtgtggtccactgacgtgacc
gtggccaacaagatggaggccggcggcatccccgggcgtgtgcacatctcacagagcacc
ttggactgcctgaaggggttcgagttcgacgtggagccgggcgacgggggcagccgctgc
gattacctggatgagaagggcatcgaaacctacctcgtcatcgcctccaagccagaggtg
aagaaaacggccgtccaaaatggcctcaatggctcggccctgcccaatggagccccccct
tcctcgcagcccagctcccccgccctcatcgagaccaaggagcccaacgggagtgtccac
gccagcgggtccacgtcggacgagcccgaggagcaaggggcccaggccgacaacccctcc
ttccccaaccctcgccggaggctgcgcctccaggacctggccgaccgcgtggtcgacgcc
tccgaggacgagcatgagctcaaccagctgctcaacgaggcgctgctcgagcgggagtcc
gcccaggtagtgaagaagaggaacaccttcctcctgtccatgcggttcatggagcccgag
atggagacgcgctactcggtggagaaggagaagcagagtggggccgccttcagctgctcc
tgcgtcgtcctgctctgcgcggccctggccgagatgctcatcgacccctggctaatgaca
aactacgtgacctttgtggttggggaagttctgcttctgatcctgacgatctgctcgctg
gctgccatctttccccaggcctttcctaagaagctcgtggccttctcaacttggatcgac
cggacccgctgggccaggaacacctgggccatgttagccatcttcattctggttatggca
aatgtcgtggacatgctcagctgcctccagttctacgcgggacccagcaacggcaccgca
gggacgggggtggaggacggctgcgcggcgaaccccgagtattacgacgacgtcgccgtg
ctgtcgctcgtggccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctc
atgctgctcatcgccggcgccgtggccgtcgtcaacatctacgcctggcgccccatcttt
gacgaatacgaccgcaggcgtttccaggagcacgactttcctgtggttgccttggagaag
atgcagatactctccaccgctgggctcaacggcactgacaggctgcccctgctgccctcc
aagtactcgatgacagcgatgatcttcgtcatgatgctgagcttttactacttctcccgc
cacgtggaaaaactggctcggacactgttcttatggaagatcgaggtccatgaccagaag
gaacgtgtctacgagatgcgacgctggaacgaggccctggtcaccaacatgttgcctgag
cacgtggcgcgccatttcctggggtccaagaagagagacgaggaactgtacagccagtct
tatgacgagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagag
gagagcatcaataatggtggcattgagtgtctgcgctttctcaacgagatcatctcagac
tttgactctctcctggacaatcccaaattccgggtcatcaccaagatcaaaaccattggc
agtacctatatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagc
tccaacaaggaggagaagtccgacaaggagcgctggcagcacctggccgatctggctgac
ttcgcactagccatgaaggatacgctcaccaacatcaacaaccagtccttcaacaacttc
atgctgcgcataggcatgaacaaaggaggggtactggctggggtcattggagcccggaaa
ccacattatgacatctggggcaacacagtcaacgtagccagcaggatggagtccacaggc
gtcatgggcaacattcaggtggtagaagacacacaggccatcctccgagagtatggcttc
cgcttcgtgaggcgagggcccatctttgtgaaagggaaaggggagctgctaacctttttc
ttgaagggccgtgacaagccagccaccttccctaacggctcctctgtcacactgccccac
caggtggtagacaactcctga

DBGET integrated database retrieval system