KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498522Help
Entry
107498522         CDS       T06036                                 

Gene name
DNMT3A
Definition
(RefSeq) DNA (cytosine-5)-methyltransferase 3A isoform X1
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00270  Cysteine and methionine metabolism
ray01100  Metabolic pathways
ray05206  MicroRNAs in cancer
Module
ray_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107498522 (DNMT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107498522 (DNMT3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ray03032]
    107498522 (DNMT3A)
   03036 Chromosome and associated proteins [BR:ray03036]
    107498522 (DNMT3A)
Enzymes [BR:ray01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     107498522 (DNMT3A)
DNA replication proteins [BR:ray03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    107498522 (DNMT3A)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107498522 (DNMT3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP
Motif
Other DBs
NCBI-GeneID: 107498522
NCBI-ProteinID: XP_015977239
LinkDB All DBs
Position
Unknown
AA seq 916 aa AA seqDB search
MPSSGPGDTSSSAPEREEDRKEGEEQEEARGKEERQEPSTTARKVGRPGRKRKHPLVESS
DTPKDPAVTSKSPSMAQDSGPSEMLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAE
TPPEASRAVENGCCTPKDGRGAPTEEGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQR
PMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAVMNAVEENQGSGESQKVEEAS
PPAVQQPTDPASPTVATTPEPVGADTGDKNATKAADDEPEYEDGRGFGIGELVWGKLRGF
SWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQP
MYRKAIYEVLQVASSRAGKLFPACHDNDESDTAKAVEVQNKQMIEWALGGFQPSGPKGLE
PPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTTEKPKVKEIIDERTRERLVYEV
RQKCRNIEDICISCGSLNVTLEHPLFIGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGG
REVLMCGKHPDIPQVRVRVPPGAAQAAIKEDPWNCYMCGHKGTYGLLRRRDDWPSRLQMF
FANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCED
SITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYDSPA
DGFLFRLSEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESN
PVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTR
SNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVP
VIRHLFAPLKEYFACV
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgccctccagcggccccggggacaccagcagctccgctccagagcgggaggaggaccgc
aaggagggagaggagcaggaggaggcacgtggcaaggaggagcggcaagagcccagcaca
actgcacggaaggtggggcggcctgggaggaagcgcaagcaccccctggtggaaagcagt
gacacgccgaaggaccctgcggtgacctccaagtccccatccatggcccaggactcgggc
ccctcagagatgttacccaatggggacttggagaagcggagtgagccccagcccgaggag
gggagccctgctgggggtcagaagggcggggccccagcagagggagagggtgcagccgag
accccacctgaagcctccagagccgtggagaatggctgctgcacccccaaggatggccga
ggagcccccacagaagagggcaaagaacagaaggagaccaacatcgagtccatgaaaatg
gagggctcccggggccggcttcggggtggcttgggctgggagtccagcctccgccagcgg
cccatgccgcggctcaccttccaggcgggggacccctactacatcagcaagcgcaagcgg
gacgagtggctggcacgctggaaaagggaggctgagaagaaagcgaaggtgattgcagta
atgaatgctgtggaagaaaaccaggggtctggcgagtctcagaaggtggaggaggccagc
cctcctgcagtgcagcagccgaccgaccccgcgtcccccactgtggccaccactcctgag
cctgtgggggccgataccggggacaagaacgccaccaaagcagccgatgacgagccggag
tacgaggacggccggggctttggcattggggagctggtgtgggggaaactgcggggcttc
tcctggtggccaggccgcattgtgtcttggtggatgaccggccggagtcgagcagccgaa
ggcacccgctgggtcatgtggttcggagacggcaagttctcagtggtgtgtgttgagaag
ctgatgccgctgagctccttttgcagtgctttccaccaggccacctacaataagcagccc
atgtaccgcaaagccatctacgaagtcctgcaggtggccagcagccgtgcggggaagctg
ttcccagcgtgccatgacaacgacgagagcgacaccgccaaggccgtggaggtgcagaac
aaacagatgatcgagtgggccctcggagggttccagccctctggccccaagggcctggag
ccaccagaagaggagaagaatccctacaaagaagtttacacagacatgtgggttgaacct
gaggcagctgcctatgcaccccctccaccagccaaaaagccccgaaagagcacaaccgag
aagcccaaggtcaaggagattattgatgaacgcacgagagagcggctggtgtacgaggtg
cggcagaagtgccggaacatcgaggacatttgcatctcttgtgggagcctcaatgtcacc
ctggaacaccctctcttcatcggaggaatgtgccaaaactgcaagaactgcttcctggag
tgtgcataccagtacgacgacgacggctatcagtcctactgcaccatctgctgcgggggc
cgcgaggtgctcatgtgtgggaagcatcccgacatccctcaggtgagggtgagggtcccc
ccaggggctgcccaggcagccatcaaggaagacccctggaactgctacatgtgtgggcac
aagggcacctacgggctgctgcggcggcgggacgactggccctctcggctccagatgttc
ttcgccaataaccacgaccaggaattcgaccctccaaaggtttacccgcctgtcccagct
gagaagaggaagcccatccgggtgctgtctctatttgatgggatcgctacagggctgctg
gtgctgaaggacctgggcattcaggtggaccgctacatcgcctcggaggtgtgcgaggac
tccatcacggtgggcatggtgcggcaccaagggaagatcatgtacgtcggggacgtccgc
agcgtcacgcagaagcatatccaggagtggggcccgttcgatctggtgattgggggcagt
ccgtgcaatgatctctccatcgtcaaccctgcccgcaagggactctacgacagcccagct
gacggctttctcttccgcctctcagagggcactggccggctcttctttgagttctaccgc
ctcctgcatgatgcgcggcccaaggagggagatgatcgccccttcttctggctctttgag
aatgtggtggccatgggcgttagtgacaagagggacatctcgcgatttcttgagtccaac
cctgtgatgattgatgccaaagaagtgtcagctgcacacagggcccgctacttctggggg
aaccttcctggtatgaacaggccgttggcatctactgtgaatgataagctggagctgcag
gagtgtctggagcatggcagaatagccaagttcagcaaagtgaggaccattactactagg
tcgaactccataaagcagggcaaagaccagcatttccccgtcttcatgaatgagaaagag
gacatcttatggtgcactgaaatggaaagggtgtttggcttccctgtccactataccgac
gtctccaacatgagccgcttggcgaggcagagactgctgggccggtcgtggagcgtgccg
gtcatccgccacctcttcgctccgctgaaggaatattttgcttgtgtgtaa

DBGET integrated database retrieval system