KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498574
Entry
107498574         CDS       T06036                                 

Gene name
TNNC1
Definition
(RefSeq) troponin C, slow skeletal and cardiac muscles
  KO
K05865  troponin C, slow skeletal and cardiac muscles
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107498574 (TNNC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107498574 (TNNC1)
   04261 Adrenergic signaling in cardiomyocytes
    107498574 (TNNC1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107498574 (TNNC1)
   05414 Dilated cardiomyopathy
    107498574 (TNNC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107498574 (TNNC1)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     107498574 (TNNC1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg DUF5580 EMG1 EF-hand_10 Dak2
Other DBs
NCBI-GeneID: 107498574
NCBI-ProteinID: XP_015977357
LinkDB
Position
Unknown
AA seq 161 aa
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgacatctacaaggctgcggtagagcagctaacagaagagcagaaaaatgagttc
aaggcagcctttgacatcttcgtgctgggtgctgaagatggttgcatcagcaccaaggag
ctgggcaaggtgatgaggatgctgggccagaaccccacacctgaggaactgcaggagatg
atcgacgaggtggatgaggatggcagcggcacagttgacttcgatgagttcctggtcatg
atggttcgatgcatgaaggatgatagcaaagggaagtctgaggaggagctgtctgacctc
tttcgcatgtttgacaaaaacgctgatggctatatcgacctggatgagctgaagataatg
cttcaggctactggagagaccatcacggaggatgacattgaggaactcatgaaggatggt
gacaagaacaatgatggccgcatcgactatgatgagttcctggagttcatgaagggggtg
gaatag

DBGET integrated database retrieval system