KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498631
Entry
107498631         CDS       T06036                                 

Definition
(RefSeq) cystatin-C-like
  KO
K13899  cystatin-C
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107498631
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ray01002]
    107498631
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107498631
Peptidases and inhibitors [BR:ray01002]
 Peptidase inhibitors
  Family I25: cystatin family
   107498631
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107498631
SSDB
Motif
Pfam: Cystatin SQAPI
Other DBs
NCBI-GeneID: 107498631
NCBI-ProteinID: XP_015977454
LinkDB
Position
Unknown
AA seq 178 aa
MPRPVSAAPGVCFASLVSSQIAPPRVPSEPTMARSPRIALLLMATLALALAVAVSPAASA
NPSKSRLLGGLEDADVNEEGVQQALSFALSEYNKASNDAFHSRAMRVVRARKQVVAGMNY
FLDVEIGRTTCTKSQPNLASCPFHDQPRLRKKALCSFQIYTVPWTGRSSMVKSSCQDA
NT seq 537 nt   +upstreamnt  +downstreamnt
atgccgaggcccgtgagtgctgctccaggcgtctgctttgcttccctcgtctcttctcaa
attgctccacctcgcgtcccctcggagccgaccatggcaagatccccgcgaatcgcgctg
ctcctgatggccactttggctctggccctggctgtggcggtgagccccgcggccagcgcg
aaccccagcaagtctcgcctactgggcggcctggaggacgcggacgtgaacgaggagggc
gtgcagcaggcactcagcttcgccctaagcgagtacaacaaggcgagcaacgacgccttc
cacagccgcgccatgcgggtggtgcgtgcccgcaagcaggtcgtggctggcatgaactac
ttcttggatgtggagatcggtcgaaccacgtgtaccaagtcccagccaaacttggccagc
tgtcccttccatgaccagccacgcctgaggaagaaggcgctctgctctttccaaatatac
actgtcccctggacgggcaggagctccatggtgaagtccagctgccaggatgcatag

DBGET integrated database retrieval system