KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498677Help
Entry
107498677         CDS       T06036                                 

Gene name
MBD4
Definition
(RefSeq) methyl-CpG-binding domain protein 4 isoform X1
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    107498677 (MBD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107498677 (MBD4)
   03400 DNA repair and recombination proteins [BR:ray03400]
    107498677 (MBD4)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     107498677 (MBD4)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    107498677 (MBD4)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     107498677 (MBD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBD HhH-GPD NUMOD1
Motif
Other DBs
NCBI-GeneID: 107498677
NCBI-ProteinID: XP_015977544
LinkDB All DBs
Position
Unknown
AA seq 571 aa AA seqDB search
MESPSLGNCEAAHLVASSERLVPERPCDLRKEDVAVGSESIEDEKQMVIKSSSECNTLLQ
EPIAASQFGGTEITECHKSVPCGWERVVKQRVSGKTAGRYDVYFISPQGLKFRSKSSLAN
YLHKNEETSLKPEDFDFTVLSKRGIKSKYKDCSMVAQTSQLQNESSISNRNLRTRSRWKK
DVFPLPSGSLELQESRKLANVNSIDLLLKENESVNDVDSKKVRKSKGKMTILKGIQIKKT
KTGSRESLLDSVQSNIKRESVYNKAEAESESVVQENQLNRTFCISDTKKSDKTFNVTSEE
KRLMKEKSLSSRSNFSFEQITSGIINKLCSTKEAEHMEKCKDTISESEEIRTKVEAGERK
EHLHIDNLKYGSEMDNNCLQTEKESTVKICQEDTIPRTQTEKRKTSLYFSSKYNKEALSP
PRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAE
VARTADWRDVSELLKPLGLYELRAKNIIKFSDEYLTKQWRYPIELHGIGKYGNDSYRIFC
INEWKQVHPEDHKLNKYHDWLWENHEKLSLS
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggagagtccaagcctggggaactgtgaagctgcccacttggtcgcctccagtgagcgc
ctagtcccagagcggccgtgtgacctccgaaaggaagatgttgctgtgggatcagaaagc
atagaagatgagaaacaaatggtgataaaaagtagcagtgagtgtaataccctgctacaa
gaacccattgctgcttctcagtttggtggtactgaaataacagaatgccataagtctgtc
ccatgtggatgggaaagagttgtgaagcaaagggtatctggaaaaacagcaggaagatat
gatgtatattttatcagcccacagggactgaagttcagatccaaaagttcacttgctaat
taccttcataaaaatgaagagacttctcttaagccagaagattttgattttactgtactt
tctaaaaggggcattaaatcaaaatataaagactgtagcatggtggctcaaacatcccaa
ctgcaaaatgaaagtagcatttcaaaccggaacctcaggacaagaagcaggtggaagaaa
gatgtatttcctctgccaagtggtagtttggaattgcaagaaagcagaaaactagctaat
gttaattccattgatttgcttttgaaagagaatgagagtgttaatgatgttgactccaaa
aaggttagaaagtccaaaggaaagatgactattctgaaaggaattcaaattaaaaaaact
aaaactgggtctcgggagagtcttctggattctgtgcaaagtaatataaaaagagaatct
gtgtataataaggcagaagctgaaagtgaatctgttgtacaagaaaatcagcttaacaga
actttctgcatttctgacaccaaaaaaagtgacaagaccttcaatgtgaccagtgaagaa
aagagacttatgaaagaaaaatcattgagttcaagatcaaattttagttttgaacaaata
acttctggcatcattaacaaattatgttcaactaaagaagcagaacacatggagaagtgc
aaggataccatttcagaatctgaggaaataagaactaaagtagaagctggggaaaggaaa
gagcatttgcatattgacaatttaaaatatggctctgaaatggacaacaactgcttacaa
actgagaaagagtctactgtgaaaatatgtcaagaagacaccatcccacggacacaaaca
gaaaaaaggaaaacaagcctatatttttccagcaaatataacaaagaagctcttagcccc
ccacgacgcaaagcctttaagaagtggacacctcctcgatcaccttttaatcttgttcaa
gaaacactttttcacgatccatggaagctcctcatcgctactatatttctcaatcggacc
tcaggcaaaatggcaatcccggtgctttgggagtttctggagaagtatccttcagctgag
gtagcaagaaccgcagactggagagatgtgtcagaacttcttaaacctcttggtctctat
gaacttcgagcaaaaaacattatcaagttctcagatgaatatctgacgaagcagtggaga
tatccgattgaacttcatgggattggcaaatatggcaatgactcctaccgaattttttgc
atcaatgagtggaagcaggtacatcctgaagaccataagttaaacaaatatcatgactgg
ctttgggaaaatcatgaaaaattaagtctgtcttaa

DBGET integrated database retrieval system