KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498704
Entry
107498704         CDS       T06036                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04218  Cellular senescence
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04668  TNF signaling pathway
ray04670  Leukocyte transendothelial migration
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04926  Relaxin signaling pathway
ray04929  GnRH secretion
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05100  Bacterial invasion of epithelial cells
ray05135  Yersinia infection
ray05142  Chagas disease
ray05146  Amoebiasis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107498704 (PIK3R1)
   04014 Ras signaling pathway
    107498704 (PIK3R1)
   04015 Rap1 signaling pathway
    107498704 (PIK3R1)
   04370 VEGF signaling pathway
    107498704 (PIK3R1)
   04630 JAK-STAT signaling pathway
    107498704 (PIK3R1)
   04668 TNF signaling pathway
    107498704 (PIK3R1)
   04066 HIF-1 signaling pathway
    107498704 (PIK3R1)
   04068 FoxO signaling pathway
    107498704 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    107498704 (PIK3R1)
   04072 Phospholipase D signaling pathway
    107498704 (PIK3R1)
   04071 Sphingolipid signaling pathway
    107498704 (PIK3R1)
   04024 cAMP signaling pathway
    107498704 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    107498704 (PIK3R1)
   04152 AMPK signaling pathway
    107498704 (PIK3R1)
   04150 mTOR signaling pathway
    107498704 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107498704 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    107498704 (PIK3R1)
   04218 Cellular senescence
    107498704 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107498704 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107498704 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107498704 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107498704 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    107498704 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    107498704 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    107498704 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    107498704 (PIK3R1)
   04660 T cell receptor signaling pathway
    107498704 (PIK3R1)
   04662 B cell receptor signaling pathway
    107498704 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    107498704 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    107498704 (PIK3R1)
   04670 Leukocyte transendothelial migration
    107498704 (PIK3R1)
   04062 Chemokine signaling pathway
    107498704 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107498704 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    107498704 (PIK3R1)
   04929 GnRH secretion
    107498704 (PIK3R1)
   04915 Estrogen signaling pathway
    107498704 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    107498704 (PIK3R1)
   04917 Prolactin signaling pathway
    107498704 (PIK3R1)
   04926 Relaxin signaling pathway
    107498704 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    107498704 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    107498704 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107498704 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107498704 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    107498704 (PIK3R1)
   04722 Neurotrophin signaling pathway
    107498704 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107498704 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    107498704 (PIK3R1)
   04380 Osteoclast differentiation
    107498704 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    107498704 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    107498704 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498704 (PIK3R1)
   05206 MicroRNAs in cancer
    107498704 (PIK3R1)
   05205 Proteoglycans in cancer
    107498704 (PIK3R1)
   05203 Viral carcinogenesis
    107498704 (PIK3R1)
   05230 Central carbon metabolism in cancer
    107498704 (PIK3R1)
   05231 Choline metabolism in cancer
    107498704 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107498704 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107498704 (PIK3R1)
   05212 Pancreatic cancer
    107498704 (PIK3R1)
   05225 Hepatocellular carcinoma
    107498704 (PIK3R1)
   05226 Gastric cancer
    107498704 (PIK3R1)
   05214 Glioma
    107498704 (PIK3R1)
   05221 Acute myeloid leukemia
    107498704 (PIK3R1)
   05220 Chronic myeloid leukemia
    107498704 (PIK3R1)
   05218 Melanoma
    107498704 (PIK3R1)
   05211 Renal cell carcinoma
    107498704 (PIK3R1)
   05215 Prostate cancer
    107498704 (PIK3R1)
   05213 Endometrial cancer
    107498704 (PIK3R1)
   05224 Breast cancer
    107498704 (PIK3R1)
   05222 Small cell lung cancer
    107498704 (PIK3R1)
   05223 Non-small cell lung cancer
    107498704 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107498704 (PIK3R1)
   05017 Spinocerebellar ataxia
    107498704 (PIK3R1)
   05020 Prion disease
    107498704 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107498704 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107498704 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    107498704 (PIK3R1)
   04931 Insulin resistance
    107498704 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107498704 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107498704 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    107498704 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498704 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    107498704 (PIK3R1)
   05161 Hepatitis B
    107498704 (PIK3R1)
   05160 Hepatitis C
    107498704 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    107498704 (PIK3R1)
   05164 Influenza A
    107498704 (PIK3R1)
   05162 Measles
    107498704 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    107498704 (PIK3R1)
   05163 Human cytomegalovirus infection
    107498704 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107498704 (PIK3R1)
   05169 Epstein-Barr virus infection
    107498704 (PIK3R1)
   05165 Human papillomavirus infection
    107498704 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107498704 (PIK3R1)
   05142 Chagas disease
    107498704 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107498704 (PIK3R1)
   01524 Platinum drug resistance
    107498704 (PIK3R1)
   01522 Endocrine resistance
    107498704 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107498704 (PIK3R1)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107498704 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 SH3_2 DUF4201 Laminin_I Lant_dehydr_C Mod_r PI_PP_I Exonuc_VII_L
Other DBs
NCBI-GeneID: 107498704
NCBI-ProteinID: XP_015977610
LinkDB
Position
Unknown
AA seq 765 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKPEAESEQQERLPKVQLC
AGFILHFVAVLAPCDARKATVSHTPLVPEGCSASTLPDLAEQFAPPDVAPPLLIKLVEAI
EKKGLECSTLYRTQSSSSPAELRQLLDCDAASVDLETIDVQVLADAFKRYLLDLPNPVIP
VAVYNEMISLAQEIQSSEDYIQLLKKLIRSPNIPHQYWLTLQYLLKHFFKLSQTSSKNLL
TARVLSELFSPLLFRFPAASSENTEHLIKIIEILISTEWSERQPAPALPPKPPKPTTVAN
NGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNK
LIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKE
DNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQ
TQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREI
DKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHH
DEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGY
GFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgagtgccgaggggtaccaatatagagcactgtatgattataaaaaggaacgagaagaa
gatattgacttacacttgggtgacatattgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaggaagccaggcctgaagaaatcggctggttaaatggctataat
gaaaccacgggggagagaggggactttccaggaacttatgtagaatatattggaaggaaa
aaaatctcgcctccgaccccaaagccccggccacctcgaccgcttcctgttgcaccaggt
tcctcaaaacctgaagcagaaagtgagcaacaagaacgcctcccaaaggtgcagctgtgt
gctggtttcatcttgcactttgtggcggtgttggcaccatgtgatgcgaggaaagccact
gtctcccacacaccgctggtgcccgagggctgttcagcttcgacacttccggatctcgca
gagcaatttgcccctcctgacgtagctccacctctgctcatcaagctcgtggaagccatt
gaaaagaaaggtctggaatgttcgactctatacagaacgcagagctccagcagccccgca
gaattacgacagcttcttgattgtgatgccgcctccgtggacttggaaacgatcgatgtt
caagttttagcagacgctttcaaacgctatctcctggacttaccaaaccctgtcattcca
gtagctgtttacaatgaaatgatttctttagcccaagaaatacaaagctccgaagactat
atccagctgttgaagaagctcattaggtcacctaacatacctcatcagtattggcttaca
cttcagtatttgctaaaacatttcttcaagctctcccaaacctccagcaaaaatcttttg
actgcaagagtcctttccgaacttttcagccctctgcttttcaggttcccagcagccagc
tctgagaatactgaacacctcataaaaattatagaaattttaatctcaacggaatggagt
gaacgacagcctgcaccagcactgcctcccaaaccaccaaaacccactactgtagccaac
aacggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctcg
agggaagaagtaaatgaaaaacttcgagatacagctgatgggacctttttggtacgagac
gcatctactaaaatgcatggtgattatactcttacactaaggaaaggaggaaataacaaa
ttaatcaaaatatttcaccgagatgggaaatatggcttctctgacccattaaccttcaac
tctgtggttgaattaataaaccactaccggaatgagtctctagctcagtacaatcccaag
ctggatgtgaaattactttatccagtgtccaaataccaacaggatcaagttgttaaagaa
gataatattgaagctgtaggaaaaaaattacatgaatataacactcaatttcaagaaaaa
agtcgggaatatgatagattatatgaggattatacccgtacttcccaggaaatccagatg
aaaagaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaa
acccaagagcggtacagcaaagaatacatagaaaagtttaaacgtgaaggcaatgagaaa
gaaatacaaaggattatgcataattatgaaaagttgaagtctcgaatcagtgaaattgtt
gacagtaggagaagactggaggaagacttaaagaagcaggctgctgagtatcgggagatt
gacaaacgcatgaacagcatcaaaccggacctcattcagctgagaaagacacgagaccag
tacttgatgtggttgacgcagaaaggagttcggcagaagaagttgaacgagtggctgggc
aatgaaaacactgaagaccaatactcactggtggaagacgatgaggatttgccccaccat
gatgagaagacatggaacgtcggaagcagcaaccgaaacaaagctgaaaacctactgcgg
gggaaacgagatggcacatttcttgtccgggaaagcagtaagcaaggctgctacgcctgc
tccgtggtggtggacggcgaggtaaagcactgtgtcataaacaaaacagcgaccggctac
ggctttgccgagccctataacctgtacagctctctgaaggaactggtgctacattaccaa
cacacttccctcgtgcagcacaacgactccctcaacgtcacactagcctacccggtgtac
gcacagcagaggcgatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513958
Entry
107513958         CDS       T06036                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00562  Inositol phosphate metabolism
ray01100  Metabolic pathways
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04218  Cellular senescence
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04668  TNF signaling pathway
ray04670  Leukocyte transendothelial migration
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04926  Relaxin signaling pathway
ray04929  GnRH secretion
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05100  Bacterial invasion of epithelial cells
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05142  Chagas disease
ray05146  Amoebiasis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107513958 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107513958 (PIK3CB)
   04014 Ras signaling pathway
    107513958 (PIK3CB)
   04015 Rap1 signaling pathway
    107513958 (PIK3CB)
   04370 VEGF signaling pathway
    107513958 (PIK3CB)
   04630 JAK-STAT signaling pathway
    107513958 (PIK3CB)
   04668 TNF signaling pathway
    107513958 (PIK3CB)
   04066 HIF-1 signaling pathway
    107513958 (PIK3CB)
   04068 FoxO signaling pathway
    107513958 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    107513958 (PIK3CB)
   04072 Phospholipase D signaling pathway
    107513958 (PIK3CB)
   04071 Sphingolipid signaling pathway
    107513958 (PIK3CB)
   04024 cAMP signaling pathway
    107513958 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    107513958 (PIK3CB)
   04152 AMPK signaling pathway
    107513958 (PIK3CB)
   04150 mTOR signaling pathway
    107513958 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107513958 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    107513958 (PIK3CB)
   04218 Cellular senescence
    107513958 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107513958 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    107513958 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107513958 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107513958 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    107513958 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    107513958 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    107513958 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    107513958 (PIK3CB)
   04660 T cell receptor signaling pathway
    107513958 (PIK3CB)
   04662 B cell receptor signaling pathway
    107513958 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    107513958 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    107513958 (PIK3CB)
   04670 Leukocyte transendothelial migration
    107513958 (PIK3CB)
   04062 Chemokine signaling pathway
    107513958 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107513958 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    107513958 (PIK3CB)
   04929 GnRH secretion
    107513958 (PIK3CB)
   04915 Estrogen signaling pathway
    107513958 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    107513958 (PIK3CB)
   04917 Prolactin signaling pathway
    107513958 (PIK3CB)
   04926 Relaxin signaling pathway
    107513958 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    107513958 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    107513958 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107513958 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107513958 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    107513958 (PIK3CB)
   04722 Neurotrophin signaling pathway
    107513958 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107513958 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    107513958 (PIK3CB)
   04380 Osteoclast differentiation
    107513958 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    107513958 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    107513958 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513958 (PIK3CB)
   05206 MicroRNAs in cancer
    107513958 (PIK3CB)
   05205 Proteoglycans in cancer
    107513958 (PIK3CB)
   05203 Viral carcinogenesis
    107513958 (PIK3CB)
   05230 Central carbon metabolism in cancer
    107513958 (PIK3CB)
   05231 Choline metabolism in cancer
    107513958 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107513958 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107513958 (PIK3CB)
   05212 Pancreatic cancer
    107513958 (PIK3CB)
   05225 Hepatocellular carcinoma
    107513958 (PIK3CB)
   05226 Gastric cancer
    107513958 (PIK3CB)
   05214 Glioma
    107513958 (PIK3CB)
   05221 Acute myeloid leukemia
    107513958 (PIK3CB)
   05220 Chronic myeloid leukemia
    107513958 (PIK3CB)
   05218 Melanoma
    107513958 (PIK3CB)
   05211 Renal cell carcinoma
    107513958 (PIK3CB)
   05215 Prostate cancer
    107513958 (PIK3CB)
   05213 Endometrial cancer
    107513958 (PIK3CB)
   05224 Breast cancer
    107513958 (PIK3CB)
   05222 Small cell lung cancer
    107513958 (PIK3CB)
   05223 Non-small cell lung cancer
    107513958 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107513958 (PIK3CB)
   05017 Spinocerebellar ataxia
    107513958 (PIK3CB)
   05020 Prion disease
    107513958 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107513958 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107513958 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    107513958 (PIK3CB)
   04931 Insulin resistance
    107513958 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107513958 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107513958 (PIK3CB)
   05135 Yersinia infection
    107513958 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    107513958 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107513958 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    107513958 (PIK3CB)
   05161 Hepatitis B
    107513958 (PIK3CB)
   05160 Hepatitis C
    107513958 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    107513958 (PIK3CB)
   05164 Influenza A
    107513958 (PIK3CB)
   05162 Measles
    107513958 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    107513958 (PIK3CB)
   05163 Human cytomegalovirus infection
    107513958 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107513958 (PIK3CB)
   05169 Epstein-Barr virus infection
    107513958 (PIK3CB)
   05165 Human papillomavirus infection
    107513958 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107513958 (PIK3CB)
   05142 Chagas disease
    107513958 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107513958 (PIK3CB)
   01524 Platinum drug resistance
    107513958 (PIK3CB)
   01522 Endocrine resistance
    107513958 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107513958 (PIK3CB)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107513958 (PIK3CB)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107513958 (PIK3CB)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4135
Other DBs
NCBI-GeneID: 107513958
NCBI-ProteinID: XP_016006688
LinkDB
Position
Unknown
AA seq 1102 aa
MPPAMADILDIWAVDSQIASDGSILVDFLLPTGIYIQLEVPREATISSIKQMLWKQVHNY
PMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGEKLDSKI
GVLIGKGLHEFDALKDPEVNEFRIKMRKLSEEKIQSLVGLSWMDWLKQTYPPEHEPSILE
NLEDKLYGGKLIVAIHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPCDY
VLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAIEAAINR
NSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCK
TIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCLAVYAVLDKVKTKKSTKTMNPSKYQ
TIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIVLHSWSSFPDELEEMLNPMGTVQTNPYTE
NATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLVELKEILDRDP
LSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQTLRKWSPLTPLSIMRT
AGSLGPWGRQGGGPINEKKWGKLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLR
QMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALANRRIGQFLFWHLRSEVHIPAVC
IQFGVILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLIKLNAMKLNRAKGKEAMHTCLKQ
NAYREALSDLQSPLNPCVILSELYVEKCKYMDSKMKPLWLVYNNKVFGEDSVGVIFKNGD
DLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSS
NVAATAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVK
KNGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCED
AYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEA
LRESWTTKVNWMAHTVRKDYRS
NT seq 3309 nt   +upstreamnt  +downstreamnt
atgcctcctgctatggcagacatccttgacatttgggcagtggattcacagatagcatct
gatggctccatactcgtggatttccttttgcccactgggatttatatccagttggaggta
cctcgggaagctaccatttcttctattaaacagatgttgtggaagcaggttcacaattac
ccaatgtttaacctccttatggaaattgactcctatatgtttgcatgtgtgaatcaaact
gctgtatatgaggaactcgaagatgaaacaagaagactgtgtgatgtcagaccttttctt
ccagttctcaagttagtgacaagaagttgtgacccaggggaaaaattagactcaaaaatt
ggagtccttataggaaaaggtctacatgaatttgatgccttgaaggatcctgaagtcaat
gaattccgaataaaaatgcgcaagctgagtgaggaaaaaattcagtcgcttgtgggattg
tcttggatggactggctaaagcaaacatatccaccagaacatgaaccatccattcttgaa
aacttagaagataagctttatggaggaaagctcattgtggctattcattttgaaaattgt
caggatgtgtttagttttcaagtatctcctaatatgaatcctatcaaagtaaatgaattg
gcaatccaaaaacgtttgactattcacgggaaagaagatgaagttagcccctgtgactat
gttttgcaagtcagtgggagagtagaatatgtgtttggtgatcacccattaattcagttc
cagtatatccgaaactgtgtaatgaacaggaccttgccgcattttatacttgtggaatgt
tgcaagatcaaaaagatgtatgaacaggaaatgattgccatagaggctgccataaatcga
aattcatctaaccttcctcttcctttaccaccaaagaaaactcgaattatttctcatgtt
tgggaaaataacaaccctttccaaattgtcttggttaagggaaataaacttaacacagaa
gaaactgtaaaagttcacgtcagggctggcctttttcatggtactgaactcctgtgtaaa
acgattgtaagctcagagatatcagggaaaaacgatcacatttggaatgaaccactggaa
tttgatattaatacttgtgacctcccacgaatggctagattatgtttggctgtttatgca
gttttggataaagtgaaaacaaaaaaatcaactaaaacaatgaatccctctaaatatcag
actatcaggaaatctgggaaagtgcattatcctgtagcgtgggtaaatacgatggttttt
gactttaaaggacagttgagatctggagacatagtattgcacagttggtcttcatttcct
gatgaacttgaagaaatgttgaatccaatgggaactgttcaaacaaatccatatacggaa
aatgcaacagctttgcatatcaaattcccagagaataaaaaacaaccttattattaccct
ccctttgataagataatcgaaaaggcagctgagattgcaagcagtgatagtgctaatgta
tcaagtcgaggtggaaaaaagtttcttgttgaactgaaggaaatcttggacagggatccc
ttgtctcagctatgtgagaatgaaatggatcttatttggactttgcgacaagactgccgc
gagaattttccacagtcactgccaaaattattactgtcgatcaagtggaataaacttgaa
gatgttgctcagaccctcagaaaatggtccccactaactcctttatccataatgaggact
gctggttcattagggccttggggaaggcagggagggggccccatcaatgagaaaaagtgg
ggtaagcttcaggcactgctacagatttggcctaaactgcccccccgggaggccctggag
cttctagatttcaactatccagatcagtatgtgcgggaatatgctgtgggctgcctgcga
caaatgagtgatgaagaactttctcagtatcttttacagctggtgcaagttttaaaatat
gagccttttcttgattgcgccctctctagatttttattagaaagagcacttgctaatcgg
aggataggacaatttctcttttggcaccttagatcagaagtgcacatccctgctgtctgc
atacaatttggtgtcatcctcgaagcatactgccggggaagcgtcgggcacatgaaagtg
ctttccaagcaggttgaagcactcaataagttaaaaactttaaatagtttaatcaaactg
aatgcaatgaagctaaacagagccaaagggaaagaggccatgcacacttgtttaaaacag
aatgcttaccgggaagccctctctgacctgcagtcacctctgaacccatgtgtcatcctc
tcagaactctatgttgaaaagtgtaaatacatggattctaaaatgaagcctttgtggctg
gtgtacaacaacaaagtgtttggtgaggattcagtcggagtgatttttaaaaatggtgat
gatttacggcaggatatgttgacactccagatgctgcgcttgatggatttactgtggaaa
gaagctggtcttgatcttcgaatgttgccttatggctgtttagcaacaggagatcgctct
ggcctcattgaagttgtgagcacctctgaaacaattgctgacattcagctgaacagtagc
aacgtggctgctacagcagccttcaataaagatgctcttctgaactggcttaaagaatac
aattctggggatgacctggaccgagccattgaggagtttaccctgtcctgtgctggctac
tgtgtagcttcttatgtccttgggattggtgacagacatagtgacaacatcatggtaaaa
aaaaatggccagctcttccacattgactttggacatattcttggaaatttcaagtctaaa
tttggcattaaaagggaacgagtgccttttattcttacttatgatttcattcacgtgatt
caacaaggaaaaacaggaaacacagaaaaatttggccggttccgccagtgttgtgaagat
gcatatctgatactacgacggcatgggaatctcttcatcactctcttcgcactaatgttg
actgcagggcttcctgagctcacatcagtcaaggatatacagtatcttaaggattctctt
gccttagggaagagcgaagaagaagcactcaagcaatttaagcaaaaatttgatgaggca
ctcagggaaagctggactactaaagtgaactggatggcccacacagttcggaaagactac
agatcttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517828
Entry
107517828         CDS       T06036                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00562  Inositol phosphate metabolism
ray01100  Metabolic pathways
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04218  Cellular senescence
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04668  TNF signaling pathway
ray04670  Leukocyte transendothelial migration
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04926  Relaxin signaling pathway
ray04929  GnRH secretion
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05100  Bacterial invasion of epithelial cells
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05142  Chagas disease
ray05146  Amoebiasis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107517828 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107517828 (PIK3CA)
   04014 Ras signaling pathway
    107517828 (PIK3CA)
   04015 Rap1 signaling pathway
    107517828 (PIK3CA)
   04370 VEGF signaling pathway
    107517828 (PIK3CA)
   04630 JAK-STAT signaling pathway
    107517828 (PIK3CA)
   04668 TNF signaling pathway
    107517828 (PIK3CA)
   04066 HIF-1 signaling pathway
    107517828 (PIK3CA)
   04068 FoxO signaling pathway
    107517828 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    107517828 (PIK3CA)
   04072 Phospholipase D signaling pathway
    107517828 (PIK3CA)
   04071 Sphingolipid signaling pathway
    107517828 (PIK3CA)
   04024 cAMP signaling pathway
    107517828 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    107517828 (PIK3CA)
   04152 AMPK signaling pathway
    107517828 (PIK3CA)
   04150 mTOR signaling pathway
    107517828 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107517828 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    107517828 (PIK3CA)
   04218 Cellular senescence
    107517828 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107517828 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    107517828 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107517828 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107517828 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    107517828 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    107517828 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    107517828 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    107517828 (PIK3CA)
   04660 T cell receptor signaling pathway
    107517828 (PIK3CA)
   04662 B cell receptor signaling pathway
    107517828 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    107517828 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    107517828 (PIK3CA)
   04670 Leukocyte transendothelial migration
    107517828 (PIK3CA)
   04062 Chemokine signaling pathway
    107517828 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107517828 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    107517828 (PIK3CA)
   04929 GnRH secretion
    107517828 (PIK3CA)
   04915 Estrogen signaling pathway
    107517828 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    107517828 (PIK3CA)
   04917 Prolactin signaling pathway
    107517828 (PIK3CA)
   04926 Relaxin signaling pathway
    107517828 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    107517828 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    107517828 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107517828 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107517828 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    107517828 (PIK3CA)
   04722 Neurotrophin signaling pathway
    107517828 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107517828 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    107517828 (PIK3CA)
   04380 Osteoclast differentiation
    107517828 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    107517828 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    107517828 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107517828 (PIK3CA)
   05206 MicroRNAs in cancer
    107517828 (PIK3CA)
   05205 Proteoglycans in cancer
    107517828 (PIK3CA)
   05203 Viral carcinogenesis
    107517828 (PIK3CA)
   05230 Central carbon metabolism in cancer
    107517828 (PIK3CA)
   05231 Choline metabolism in cancer
    107517828 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107517828 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107517828 (PIK3CA)
   05212 Pancreatic cancer
    107517828 (PIK3CA)
   05225 Hepatocellular carcinoma
    107517828 (PIK3CA)
   05226 Gastric cancer
    107517828 (PIK3CA)
   05214 Glioma
    107517828 (PIK3CA)
   05221 Acute myeloid leukemia
    107517828 (PIK3CA)
   05220 Chronic myeloid leukemia
    107517828 (PIK3CA)
   05218 Melanoma
    107517828 (PIK3CA)
   05211 Renal cell carcinoma
    107517828 (PIK3CA)
   05215 Prostate cancer
    107517828 (PIK3CA)
   05213 Endometrial cancer
    107517828 (PIK3CA)
   05224 Breast cancer
    107517828 (PIK3CA)
   05222 Small cell lung cancer
    107517828 (PIK3CA)
   05223 Non-small cell lung cancer
    107517828 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107517828 (PIK3CA)
   05017 Spinocerebellar ataxia
    107517828 (PIK3CA)
   05020 Prion disease
    107517828 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107517828 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107517828 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    107517828 (PIK3CA)
   04931 Insulin resistance
    107517828 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107517828 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107517828 (PIK3CA)
   05135 Yersinia infection
    107517828 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    107517828 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107517828 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    107517828 (PIK3CA)
   05161 Hepatitis B
    107517828 (PIK3CA)
   05160 Hepatitis C
    107517828 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    107517828 (PIK3CA)
   05164 Influenza A
    107517828 (PIK3CA)
   05162 Measles
    107517828 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    107517828 (PIK3CA)
   05163 Human cytomegalovirus infection
    107517828 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107517828 (PIK3CA)
   05169 Epstein-Barr virus infection
    107517828 (PIK3CA)
   05165 Human papillomavirus infection
    107517828 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107517828 (PIK3CA)
   05142 Chagas disease
    107517828 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107517828 (PIK3CA)
   01524 Platinum drug resistance
    107517828 (PIK3CA)
   01522 Endocrine resistance
    107517828 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107517828 (PIK3CA)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107517828 (PIK3CA)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107517828 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 107517828
NCBI-ProteinID: XP_016014488
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYAHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgactttagaatgcctccgtgaggct
acattaataactataaagcatgaactttttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctctttcaaccctttttaaaa
gtaattgagccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggctttgct
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagttcaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agcagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaatcatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgttatcatctgaacaactaaaa
ctttgtgttttagaatatcagggcaaatatattttaaaagtatgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtacataagaagctgcataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctttactctcaactgccaatggac
tgttttacaatgccgtcttattctagacgtatctccacagctacaccgtatatgaatgga
gaaacatctacaaaatccctttgggttataaatagcgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatctatgttagaacaggtatc
taccacggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgagtggctgaattatgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgtaaaaggccgaaagggtgctaaagaggaacactgc
ccattggcctggggaaatataaacctgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggattagaagatttactgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaattggtctgtg
tcccgagaagcaggatttagttatgcccacgcaggactgagtaacagactagccagagac
aacgaattaagggaaaatgataaagaacagctccgagcaatttgtacccgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacaggcactattgtgtaact
atccctgaaattctacctaaattgcttctctccgttaaatggaattctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaaacctgaacaggctatggag
cttctagactgcaactacccagatcctatggttcgaggttttgctgttcgatgcttggaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacttgcttgtgagatttttactcaagaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctacttctggaatcctattgtcgtgcatgtggaatgtatttgaag
cacctgaataggcaagttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtgcagatgaagtttttagttgagcaaatgcgg
cgaccagatttcatggatgctctgcagggctttctatctcctctaaaccctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcagattatccgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccatatggttgtctctca
attggtgactgtgtgggacttattgaagtggtgagaaattctcacactattatgcaaatt
cagtgcaaaggcggcctgaaaggtgcactgcagttcaacagccacacactacatcagtgg
ctcaaagacaagaacaaaggagaaatatacgatgcagccattgatctgtttacacgttca
tgtgctggatattgtgttgctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaatttggctataaacgagagcgtgtgccatttgttttgactcaagatttc
ttgatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgaaaggttt
caggagatgtgttacaaagcttatctagctattcggcagcatgccaatctctttataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgaacaagaagctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccat
acaattaagcagcatgctttgaactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517899
Entry
107517899         CDS       T06036                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04218  Cellular senescence
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04668  TNF signaling pathway
ray04670  Leukocyte transendothelial migration
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04926  Relaxin signaling pathway
ray04929  GnRH secretion
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05100  Bacterial invasion of epithelial cells
ray05135  Yersinia infection
ray05142  Chagas disease
ray05146  Amoebiasis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107517899 (PIK3R3)
   04014 Ras signaling pathway
    107517899 (PIK3R3)
   04015 Rap1 signaling pathway
    107517899 (PIK3R3)
   04370 VEGF signaling pathway
    107517899 (PIK3R3)
   04630 JAK-STAT signaling pathway
    107517899 (PIK3R3)
   04668 TNF signaling pathway
    107517899 (PIK3R3)
   04066 HIF-1 signaling pathway
    107517899 (PIK3R3)
   04068 FoxO signaling pathway
    107517899 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    107517899 (PIK3R3)
   04072 Phospholipase D signaling pathway
    107517899 (PIK3R3)
   04071 Sphingolipid signaling pathway
    107517899 (PIK3R3)
   04024 cAMP signaling pathway
    107517899 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    107517899 (PIK3R3)
   04152 AMPK signaling pathway
    107517899 (PIK3R3)
   04150 mTOR signaling pathway
    107517899 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107517899 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    107517899 (PIK3R3)
   04218 Cellular senescence
    107517899 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107517899 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    107517899 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107517899 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107517899 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    107517899 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    107517899 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    107517899 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    107517899 (PIK3R3)
   04660 T cell receptor signaling pathway
    107517899 (PIK3R3)
   04662 B cell receptor signaling pathway
    107517899 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    107517899 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    107517899 (PIK3R3)
   04670 Leukocyte transendothelial migration
    107517899 (PIK3R3)
   04062 Chemokine signaling pathway
    107517899 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107517899 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    107517899 (PIK3R3)
   04929 GnRH secretion
    107517899 (PIK3R3)
   04915 Estrogen signaling pathway
    107517899 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    107517899 (PIK3R3)
   04917 Prolactin signaling pathway
    107517899 (PIK3R3)
   04926 Relaxin signaling pathway
    107517899 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    107517899 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    107517899 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107517899 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107517899 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    107517899 (PIK3R3)
   04722 Neurotrophin signaling pathway
    107517899 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107517899 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    107517899 (PIK3R3)
   04380 Osteoclast differentiation
    107517899 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    107517899 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    107517899 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107517899 (PIK3R3)
   05206 MicroRNAs in cancer
    107517899 (PIK3R3)
   05205 Proteoglycans in cancer
    107517899 (PIK3R3)
   05203 Viral carcinogenesis
    107517899 (PIK3R3)
   05230 Central carbon metabolism in cancer
    107517899 (PIK3R3)
   05231 Choline metabolism in cancer
    107517899 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107517899 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107517899 (PIK3R3)
   05212 Pancreatic cancer
    107517899 (PIK3R3)
   05225 Hepatocellular carcinoma
    107517899 (PIK3R3)
   05226 Gastric cancer
    107517899 (PIK3R3)
   05214 Glioma
    107517899 (PIK3R3)
   05221 Acute myeloid leukemia
    107517899 (PIK3R3)
   05220 Chronic myeloid leukemia
    107517899 (PIK3R3)
   05218 Melanoma
    107517899 (PIK3R3)
   05211 Renal cell carcinoma
    107517899 (PIK3R3)
   05215 Prostate cancer
    107517899 (PIK3R3)
   05213 Endometrial cancer
    107517899 (PIK3R3)
   05224 Breast cancer
    107517899 (PIK3R3)
   05222 Small cell lung cancer
    107517899 (PIK3R3)
   05223 Non-small cell lung cancer
    107517899 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107517899 (PIK3R3)
   05017 Spinocerebellar ataxia
    107517899 (PIK3R3)
   05020 Prion disease
    107517899 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107517899 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107517899 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    107517899 (PIK3R3)
   04931 Insulin resistance
    107517899 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107517899 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107517899 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    107517899 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107517899 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    107517899 (PIK3R3)
   05161 Hepatitis B
    107517899 (PIK3R3)
   05160 Hepatitis C
    107517899 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    107517899 (PIK3R3)
   05164 Influenza A
    107517899 (PIK3R3)
   05162 Measles
    107517899 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    107517899 (PIK3R3)
   05163 Human cytomegalovirus infection
    107517899 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107517899 (PIK3R3)
   05169 Epstein-Barr virus infection
    107517899 (PIK3R3)
   05165 Human papillomavirus infection
    107517899 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107517899 (PIK3R3)
   05142 Chagas disease
    107517899 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107517899 (PIK3R3)
   01524 Platinum drug resistance
    107517899 (PIK3R3)
   01522 Endocrine resistance
    107517899 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107517899 (PIK3R3)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107517899 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 PI_PP_I DUF5638
Other DBs
NCBI-GeneID: 107517899
NCBI-ProteinID: XP_016014541
LinkDB
Position
Unknown
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPVTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSKYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQYSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYGSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccgaag
ccacctaagccagttacttcagccgttacaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattacgg
gatatgccagatggtaccttcttggtcagagatgcctcaacaaaaatgcagggagattac
actttgactttgcggaagggaggcaataataaattaataaaaatctatcatcgagatggt
aaatatggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
catcatgaatctcttgctcagtacaatcccaaacttgatgtgaagctaatgtacccagtg
tccaaataccaacaggatcagttggtaaaagaagataacattgatgcagttggtaaaaaa
ctacaagagtatcactcccagtatcaggaaaagagtaaagagtatgacagattatatgaa
gaatacaccagaacatctcaggaaatacagatgaagcggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcacacacaagaacaatatagcaaagaatat
attgagcgatttcgcagagaggggaatgaaaaggaaattgaacgaattatgatgaattat
gataaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagtattaaacct
gacttgatccagctgcgcaagatccgagatcagcaccttgtatggcttaatcacaaagga
gtgagacagaagcgcctgaatgcctggctgggaatcaagaatgaggatgctgatgagacc
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacccgacggtgcattc
ttaattcgtgagagtagcaagaaaggatgttacgcttgctctgtggttgccgatggggaa
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgcagagccctacaac
ctgtatggctcactgaaggagctggtgctgcattaccagcagacatccctcgtccagcac
aacgactccctcaacgtcaggcttgcctaccctgtccatgcacagatgccctcgctctgc
agataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520152
Entry
107520152         CDS       T06036                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00562  Inositol phosphate metabolism
ray01100  Metabolic pathways
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04218  Cellular senescence
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04668  TNF signaling pathway
ray04670  Leukocyte transendothelial migration
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04926  Relaxin signaling pathway
ray04929  GnRH secretion
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05100  Bacterial invasion of epithelial cells
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05142  Chagas disease
ray05146  Amoebiasis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107520152 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107520152 (PIK3CD)
   04014 Ras signaling pathway
    107520152 (PIK3CD)
   04015 Rap1 signaling pathway
    107520152 (PIK3CD)
   04370 VEGF signaling pathway
    107520152 (PIK3CD)
   04630 JAK-STAT signaling pathway
    107520152 (PIK3CD)
   04668 TNF signaling pathway
    107520152 (PIK3CD)
   04066 HIF-1 signaling pathway
    107520152 (PIK3CD)
   04068 FoxO signaling pathway
    107520152 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    107520152 (PIK3CD)
   04072 Phospholipase D signaling pathway
    107520152 (PIK3CD)
   04071 Sphingolipid signaling pathway
    107520152 (PIK3CD)
   04024 cAMP signaling pathway
    107520152 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    107520152 (PIK3CD)
   04152 AMPK signaling pathway
    107520152 (PIK3CD)
   04150 mTOR signaling pathway
    107520152 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107520152 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    107520152 (PIK3CD)
   04218 Cellular senescence
    107520152 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107520152 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    107520152 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107520152 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107520152 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    107520152 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    107520152 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    107520152 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    107520152 (PIK3CD)
   04660 T cell receptor signaling pathway
    107520152 (PIK3CD)
   04662 B cell receptor signaling pathway
    107520152 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    107520152 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    107520152 (PIK3CD)
   04670 Leukocyte transendothelial migration
    107520152 (PIK3CD)
   04062 Chemokine signaling pathway
    107520152 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107520152 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    107520152 (PIK3CD)
   04929 GnRH secretion
    107520152 (PIK3CD)
   04915 Estrogen signaling pathway
    107520152 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    107520152 (PIK3CD)
   04917 Prolactin signaling pathway
    107520152 (PIK3CD)
   04926 Relaxin signaling pathway
    107520152 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    107520152 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    107520152 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107520152 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107520152 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    107520152 (PIK3CD)
   04722 Neurotrophin signaling pathway
    107520152 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107520152 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    107520152 (PIK3CD)
   04380 Osteoclast differentiation
    107520152 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    107520152 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    107520152 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107520152 (PIK3CD)
   05206 MicroRNAs in cancer
    107520152 (PIK3CD)
   05205 Proteoglycans in cancer
    107520152 (PIK3CD)
   05203 Viral carcinogenesis
    107520152 (PIK3CD)
   05230 Central carbon metabolism in cancer
    107520152 (PIK3CD)
   05231 Choline metabolism in cancer
    107520152 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107520152 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107520152 (PIK3CD)
   05212 Pancreatic cancer
    107520152 (PIK3CD)
   05225 Hepatocellular carcinoma
    107520152 (PIK3CD)
   05226 Gastric cancer
    107520152 (PIK3CD)
   05214 Glioma
    107520152 (PIK3CD)
   05221 Acute myeloid leukemia
    107520152 (PIK3CD)
   05220 Chronic myeloid leukemia
    107520152 (PIK3CD)
   05218 Melanoma
    107520152 (PIK3CD)
   05211 Renal cell carcinoma
    107520152 (PIK3CD)
   05215 Prostate cancer
    107520152 (PIK3CD)
   05213 Endometrial cancer
    107520152 (PIK3CD)
   05224 Breast cancer
    107520152 (PIK3CD)
   05222 Small cell lung cancer
    107520152 (PIK3CD)
   05223 Non-small cell lung cancer
    107520152 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107520152 (PIK3CD)
   05017 Spinocerebellar ataxia
    107520152 (PIK3CD)
   05020 Prion disease
    107520152 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107520152 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107520152 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    107520152 (PIK3CD)
   04931 Insulin resistance
    107520152 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107520152 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107520152 (PIK3CD)
   05135 Yersinia infection
    107520152 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    107520152 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107520152 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    107520152 (PIK3CD)
   05161 Hepatitis B
    107520152 (PIK3CD)
   05160 Hepatitis C
    107520152 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    107520152 (PIK3CD)
   05164 Influenza A
    107520152 (PIK3CD)
   05162 Measles
    107520152 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    107520152 (PIK3CD)
   05163 Human cytomegalovirus infection
    107520152 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107520152 (PIK3CD)
   05169 Epstein-Barr virus infection
    107520152 (PIK3CD)
   05165 Human papillomavirus infection
    107520152 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107520152 (PIK3CD)
   05142 Chagas disease
    107520152 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107520152 (PIK3CD)
   01524 Platinum drug resistance
    107520152 (PIK3CD)
   01522 Endocrine resistance
    107520152 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107520152 (PIK3CD)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     107520152 (PIK3CD)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107520152 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 107520152
NCBI-ProteinID: XP_016019063
LinkDB
Position
Unknown
AA seq 1044 aa
MPPGVDCPMEFWTKEENQNVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLRDPEVNDFRAKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARTWGP
GTLRVPSRALLVNVKFEGSEESFTFQVSSKDVPLSLMACALRKKATVFRQSPVEQPEDYA
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSDPAPQVQKPR
TKPPPIPMKKPSSVSLWSLEQPFCIQLIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVNVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLTLFDYKDQLKTGECCLYMWPSVPDEKGELLNPTGTVRSNPNTESAAALIICLPEVAP
HPVYYPALDKILELGRHGEHGRFTEEEQLQLREILERRASGELYEHEKDLVWKMRHEVQE
RFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDSSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELAKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKSPKPQTKELLHLCMR
QETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSEGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgcccccaggggttgactgccccatggaattctggaccaaggaggagaatcagaacgtg
gcagttgacttcttgctgcccacgggggtctacctgaacttccctgtgtcccgaaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgagcccagtatgagccgctgttccac
atgctcagcgaccccgaggcctacgtgttcacctgtgtcaaccagactgcggagcagcag
gagctggaggacgagcagcggcggctgtgtgacatccagcccttcctgccggtcctacgc
ctggtggcccgtgagggcgacagggtgaagaagctcatcaactcgcagatcagccttctc
atcggcaaaggcctccacgagtttgactctttgcgcgacccggaagtgaacgactttcga
gccaagatgcgccagttctgcgaggaggcggccgcccgccgccagcagctgggctgggag
gcctggctgcagtacagcttccccctgcagctggagccctcggctcgcacctgggggcct
ggcaccctgcgcgtccccagccgggcccttctggtcaacgtcaagttcgagggcagtgag
gagagcttcaccttccaggtgtccagcaaggatgtgcccttgtcgctgatggcctgtgcc
ctccggaagaaggccaccgtcttccggcagtccccagtggagcagcccgaggactacgcc
ctgcaggtgaacggcaagcacgagtacctgtacggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagcgggctgaccccccacctgacgatggtgcattcctcc
tccatcctggccatgcgggacgagcagagcgaccctgccccccaagtccaaaagccgcgc
accaaaccgccccccatccccatgaagaagccctcctccgtgtccctgtggtccttggag
caacccttctgcatccagctgatccagggcagcaaagtgaatgccgacgagcggatgaag
ctggtggtgcaggcggggctgttccacggcaacgagacgctgtgcaagacggtgtccagc
tccgaggtgaacgtgtgctcggagcccgtgtggaagcagcgcctggagttcgacatcaac
gtctgcgacctgccgcgcatggcccgcctctgcttcgcgctgtacgccgtcatcgagaag
gccaagaaggcccgctccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcaccctgttcgactacaaggaccagctcaagacgggcgaatgctgcctctac
atgtggccctctgtcccagacgagaagggggagctgctgaaccccacgggaaccgtgcga
agcaaccccaacaccgagagtgctgccgccctgatcatctgtctccccgaggtggccccc
caccctgtgtactaccctgccctggacaagatcctggagctggggcggcacggggagcac
ggccgcttcacggaggaggagcagctgcagctgcgggaaatcctggagcggcgggcgtcg
ggggagctgtacgagcacgagaaggacctggtgtggaagatgcggcacgaggtgcaggag
cgctttccggaggcgctggcccggctgctgctggtcaccaagtggaacaagcacgaggac
gtggcccagatgctctacctgctctgctcctggcccgagctgcccgtcctgagcgccctg
gagctgctggactccagcttccccgaccgccacgtgggctccttcgccatcaagtccttg
cggaagctcacggacgacgagctcttccaatacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctcgactgcgaactcgccaaattcctgctggaccgggccctggccaac
cgcaagatcggccacttcctcttctggcacctccgctccgagatgcacgtgccgtcggtg
gccctgcgcttcggcctcatcatggaagcctactgcaggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcgctcagcaaactgaaggccctgaacgactttgtcaaa
gtgagctcccagaagagccccaagccccagaccaaggagctgttgcacctgtgcatgcgc
caggagacctacctggaggccctctcccacctgcagtccccactcgaccccagcaccctg
ctggctgaagtctgtgtggaacagtgcaccttcatggactccaagatgaagccgctgtgg
gtcatgtacagcaacgaggaggcaggcagcgagggcagcgtgggcatcatcttcaagaat
ggggacgacctccggcaggacatgctgactctgcagatgatccagctcatggacgttctg
tggaagcaggagggcttggacctgaggatgaccccctacggctgcctctccacgggggac
cgcacgggcctcattgaggtggtgctgcactcggacaccatcgccaacatccagctgaac
aagagcaacatggcggccacggccgccttcaacaaggacgccctgctcaactggctcaag
tccaagaaccccggggaggccctggatcgcgccatcgaggagttcaccctctcctgcgct
ggctactgtgtggccacctatgtgctgggcatcggagaccggcacagcgacaacatcatg
atccgcgagaacgggcagctcttccacatcgactttggccactttctggggaacttcaaa
accaagtttggaatcaaccgtgagcgagtcccattcatcctcacctatgacttcgtccat
gtgatccagcaggggaagactaataatagtgagaaatttgaaaggtttcgcggctactgc
gagagggcctacaccatcctgcggcgccacgggctgctcttcctccacctcttcgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaggacatccagtatctcaaggac
tccctggcgttggggaagacggaggaggaggcgctaaagcacttccgagtgaagtttaac
gaggccctccgggagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacaggcaatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521668
Entry
107521668         CDS       T06036                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04218  Cellular senescence
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04620  Toll-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04668  TNF signaling pathway
ray04670  Leukocyte transendothelial migration
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04926  Relaxin signaling pathway
ray04929  GnRH secretion
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray04973  Carbohydrate digestion and absorption
ray05010  Alzheimer disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05100  Bacterial invasion of epithelial cells
ray05135  Yersinia infection
ray05142  Chagas disease
ray05146  Amoebiasis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107521668 (PIK3R2)
   04014 Ras signaling pathway
    107521668 (PIK3R2)
   04015 Rap1 signaling pathway
    107521668 (PIK3R2)
   04370 VEGF signaling pathway
    107521668 (PIK3R2)
   04630 JAK-STAT signaling pathway
    107521668 (PIK3R2)
   04668 TNF signaling pathway
    107521668 (PIK3R2)
   04066 HIF-1 signaling pathway
    107521668 (PIK3R2)
   04068 FoxO signaling pathway
    107521668 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    107521668 (PIK3R2)
   04072 Phospholipase D signaling pathway
    107521668 (PIK3R2)
   04071 Sphingolipid signaling pathway
    107521668 (PIK3R2)
   04024 cAMP signaling pathway
    107521668 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    107521668 (PIK3R2)
   04152 AMPK signaling pathway
    107521668 (PIK3R2)
   04150 mTOR signaling pathway
    107521668 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107521668 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    107521668 (PIK3R2)
   04218 Cellular senescence
    107521668 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107521668 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    107521668 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107521668 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107521668 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    107521668 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    107521668 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    107521668 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    107521668 (PIK3R2)
   04660 T cell receptor signaling pathway
    107521668 (PIK3R2)
   04662 B cell receptor signaling pathway
    107521668 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    107521668 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    107521668 (PIK3R2)
   04670 Leukocyte transendothelial migration
    107521668 (PIK3R2)
   04062 Chemokine signaling pathway
    107521668 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107521668 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    107521668 (PIK3R2)
   04929 GnRH secretion
    107521668 (PIK3R2)
   04915 Estrogen signaling pathway
    107521668 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    107521668 (PIK3R2)
   04917 Prolactin signaling pathway
    107521668 (PIK3R2)
   04926 Relaxin signaling pathway
    107521668 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    107521668 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    107521668 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107521668 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107521668 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    107521668 (PIK3R2)
   04722 Neurotrophin signaling pathway
    107521668 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107521668 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    107521668 (PIK3R2)
   04380 Osteoclast differentiation
    107521668 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    107521668 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    107521668 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107521668 (PIK3R2)
   05206 MicroRNAs in cancer
    107521668 (PIK3R2)
   05205 Proteoglycans in cancer
    107521668 (PIK3R2)
   05203 Viral carcinogenesis
    107521668 (PIK3R2)
   05230 Central carbon metabolism in cancer
    107521668 (PIK3R2)
   05231 Choline metabolism in cancer
    107521668 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107521668 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107521668 (PIK3R2)
   05212 Pancreatic cancer
    107521668 (PIK3R2)
   05225 Hepatocellular carcinoma
    107521668 (PIK3R2)
   05226 Gastric cancer
    107521668 (PIK3R2)
   05214 Glioma
    107521668 (PIK3R2)
   05221 Acute myeloid leukemia
    107521668 (PIK3R2)
   05220 Chronic myeloid leukemia
    107521668 (PIK3R2)
   05218 Melanoma
    107521668 (PIK3R2)
   05211 Renal cell carcinoma
    107521668 (PIK3R2)
   05215 Prostate cancer
    107521668 (PIK3R2)
   05213 Endometrial cancer
    107521668 (PIK3R2)
   05224 Breast cancer
    107521668 (PIK3R2)
   05222 Small cell lung cancer
    107521668 (PIK3R2)
   05223 Non-small cell lung cancer
    107521668 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107521668 (PIK3R2)
   05017 Spinocerebellar ataxia
    107521668 (PIK3R2)
   05020 Prion disease
    107521668 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107521668 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107521668 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    107521668 (PIK3R2)
   04931 Insulin resistance
    107521668 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107521668 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107521668 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    107521668 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107521668 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    107521668 (PIK3R2)
   05161 Hepatitis B
    107521668 (PIK3R2)
   05160 Hepatitis C
    107521668 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    107521668 (PIK3R2)
   05164 Influenza A
    107521668 (PIK3R2)
   05162 Measles
    107521668 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    107521668 (PIK3R2)
   05163 Human cytomegalovirus infection
    107521668 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107521668 (PIK3R2)
   05169 Epstein-Barr virus infection
    107521668 (PIK3R2)
   05165 Human papillomavirus infection
    107521668 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107521668 (PIK3R2)
   05142 Chagas disease
    107521668 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107521668 (PIK3R2)
   01524 Platinum drug resistance
    107521668 (PIK3R2)
   01522 Endocrine resistance
    107521668 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107521668 (PIK3R2)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    107521668 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 ATG11 Ribosomal_L22e Tai4 Laminin_I
Other DBs
NCBI-GeneID: 107521668
NCBI-ProteinID: XP_016022043
LinkDB
Position
Unknown
AA seq 755 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDLLVVSRAALQVLGVAEGSERCPQNVGWMPGL
NERTRQRGDFPGTYVEFLGPVALSRPGPRPRGPRPLPARPQEGASEPGPTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESLYRPELPALRTDWSLSDVEQWDAATLADGIKGFLLA
LPSPIITPEAVAEARRALREAVGPIGPVLEPPTLPLHHALTLRFLLQHLGRMARRASAPG
PAVRALGTAFGPLLQLRTAPPSPPPLGGAPDGCTSTCKTVCTPMSRQPYPALTALPSPRT
ELIPDFPALLVEKLLQEHLEEQEVAPPALPPKPPKAKPTPLGLANGGSPLSLQDAEWYWG
DISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPL
TFCSVVDLIAHYRHESLAQYNAKLDTRLLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQY
QDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREG
NEKEMQRILLNSERLKSRIAEIHESRTKLEQELRAQALDNREIDKRMNSLKPDLMQLRKI
RDQYLVWLTQKGTRQKKINEWLGIKNETEDQYALMEDEDDLPHHEERTWYVGKINRTQAE
EMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGLGFAEPYNLYGSLKELV
LHYQHTSLVQHNDALTVTLAHPVRAPGPGPPPTTR
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggctggcgctgagggcttccagtaccgtgcactgtacccgttccgtcgggagcggcca
gaggacctggagctgctgccaggcgacttgctggtggtgagccgggcggccctgcaggtc
ctgggtgtggccgagggcagcgagcgctgcccacagaacgtgggctggatgcctggcctc
aacgaacgcacacggcagcgcggtgattttccaggcacctatgtcgagttcctggggcct
gtggccctgtccagacctggccctcgcccccgtggtccccgcccactgcccgccaggccc
caagagggggcctccgagccaggccccacactccctgacctgcctgagcagttttcccca
cctgatgtggctccccctctcctggtgaagcttgtggaggccattgagcggacagggcta
gacagtgaatccctctacaggcccgagctgcctgccctgcgcacagattggtccctgagc
gatgtggaacagtgggatgcggcaactctggcggatggcatcaagggcttcttgctggct
ctgccctcacccatcataacaccggaggccgtggctgaggctcgccgggccctgcgggag
gccgtgggacccatagggccggtgctggagcccccaacgctaccactgcaccatgcgctc
acgctgcgcttcctgctccagcatcttggtcgcatggccaggcgtgcctctgcccctggt
ccagcggtgcgagccctgggcactgccttcgggccactgctacagctgcgcactgcaccg
ccttcgccgcccccactagggggcgcacctgatgggtgtacaagcacatgcaagaccgtg
tgcacacccatgagcagacagccctacccagcgctaaccgcactcccctcccccaggact
gagctcatcccggacttcccagccttgctggtggaaaagttgcttcaggagcacctggag
gagcaggaggttgcacccccagcactgccacctaaaccacccaaagcaaagcccaccccc
ctagggctggccaacggggggagcccactctccctgcaggatgctgagtggtactggggt
gacatctccagggaggaggtgaacgaaaaactccgggacacacctgatggtaccttcctg
gtccgagatgcctccagcaagatccagggagagtacactcttaccctcaggaaaggcggg
aacaacaagctgattaaggtcttccaccgcgacgggcactatggcttctcagagccactc
accttctgctctgttgtggacctcattgcccactaccgccatgagtccctggcccagtac
aacgccaaactggacacgcggctcctctaccctgtatccaagtaccagcaggaccagatc
gtcaaggaggacagtgtggaagcagtgggtgcccagctcaaagtctaccaccagcagtac
caggacaagagccgcgagtacgaccagctctacgaggagtacacacgcacctcccaggaa
ctgcagatgaagcgcaccgcaattgaggccttcaacgaaaccatcaagatctttgaagag
cagggccagacgcaagagaagtgtagcaaggaatatctggaacgcttccggcgtgagggc
aatgagaaagagatgcagagaatcctgctgaactcggagcgactcaagtcccgcattgct
gaaatccatgagagccgcacgaagctggaacaggagctgcgggcacaggccttggacaac
cgggagattgacaagcgcatgaacagcctaaagccagacctcatgcagctgcgcaagatc
cgagaccagtacctggtatggctcacccagaaaggcacccggcagaagaaaatcaacgaa
tggttggggatcaaaaatgagactgaggaccagtacgccctgatggaggacgaggatgac
ctgccccaccacgaggaacgcacctggtacgtgggcaagatcaaccgcacacaggcagag
gaaatgctgagcggcaaacgagatggcaccttcctcatccgtgagagcagccagcggggc
tgctacgcctgctctgtggtggtggacggcgacaccaagcactgcgttatctaccgcacg
gccaccggcttgggctttgcagagccctacaatctctatgggtccttaaaggagctggtg
ctgcattaccaacacacctccttggtgcagcacaacgacgcgctcactgtcactttggcc
caccccgttcgggcccctggccctgggcccccacccaccacccgctga

DBGET integrated database retrieval system