KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498709
Entry
107498709         CDS       T06036                                 

Gene name
ATP1B4
Definition
(RefSeq) protein ATP1B4 isoform X1
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04911  Insulin secretion
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04964  Proximal tubule bicarbonate reclamation
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray04974  Protein digestion and absorption
ray04976  Bile secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107498709 (ATP1B4)
   04022 cGMP-PKG signaling pathway
    107498709 (ATP1B4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107498709 (ATP1B4)
   04918 Thyroid hormone synthesis
    107498709 (ATP1B4)
   04919 Thyroid hormone signaling pathway
    107498709 (ATP1B4)
   04925 Aldosterone synthesis and secretion
    107498709 (ATP1B4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107498709 (ATP1B4)
   04261 Adrenergic signaling in cardiomyocytes
    107498709 (ATP1B4)
  09154 Digestive system
   04970 Salivary secretion
    107498709 (ATP1B4)
   04971 Gastric acid secretion
    107498709 (ATP1B4)
   04972 Pancreatic secretion
    107498709 (ATP1B4)
   04976 Bile secretion
    107498709 (ATP1B4)
   04973 Carbohydrate digestion and absorption
    107498709 (ATP1B4)
   04974 Protein digestion and absorption
    107498709 (ATP1B4)
   04978 Mineral absorption
    107498709 (ATP1B4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107498709 (ATP1B4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107498709 (ATP1B4)
   04964 Proximal tubule bicarbonate reclamation
    107498709 (ATP1B4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107498709 (ATP1B4)
CD molecules [BR:ray04090]
 Proteins
  107498709 (ATP1B4)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 107498709
NCBI-ProteinID: XP_015977634
LinkDB
Position
Unknown
AA seq 353 aa
MRRQLRSRRALASPYGYLYRLDDQDEVNQNYFADEEEEAEEEAQVMVVPYLEEEKEEEKE
EEEKEDEDSQGQPTCNTWWQKLQIMNEYLWDPEKRMSLARTGQSWSLILVIYFFFYASLA
AVITLCMYMLFLTIGLYTPTFTERVKPPGVMIRPFAHSLNFNFNISEPDTWQHYVISLNG
FLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDSTFGYSTGQ
PCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSINYYPESASFDLRYYPYYGKLTH
VNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIINDVINDHFMGRVIFTLNIET
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgagaaggcagctccggtccagaagggctctggcctctccttatggttatctctacaga
cttgatgatcaggatgaagtgaaccagaactactttgcagatgaagaggaagaagcagaa
gaggaggctcaggtgatggtggtaccttatttggaggaggaaaaagaagaggagaaagaa
gaggaagaaaaggaagatgaagacagtcagggtcagccaacatgcaacacctggtggcag
aaattgcagatcatgaatgaatacctgtgggatccggagaaaaggatgtctctggcccga
acaggtcagagttggagcctgatcttagtcatttacttcttcttctatgcctccttggct
gctgtgatcaccctctgcatgtacatgctatttctgaccatcggtctttacacgccaacc
ttcaccgagagggtgaagcctcctggagttatgatcagacccttcgcccatagccttaac
ttcaacttcaacatttctgaacctgacacttggcagcattatgtgattagcctaaatggc
tttctccagggttataatgacagtcttcaagaggaaatgaatgtagattgtcccccgggg
cagtacttcattcaagatggcaatgaagatgaggacaagaaggcctgccaatttaagcgc
tccttcctgaagaactgctctggcctggaggattctacttttggctactctactggacag
ccctgcatccttctaaagatgaacaggattgtaggctttcgtcctgagcttggagatcct
gtgaaggtttcctgcaaagttcagagaggagatgaaaatgacatccgatccatcaattac
tacccagagtcggcttcttttgacctccgctactatccttactacggcaaactgactcac
gttaactacacctccccgctggtggcaatgcactttacagacgtggtgaagaaccaagcc
gtgcctgtgcagtgccaactgaagggcaaaggcatcataaatgatgtcatcaatgatcat
tttatgggtagggtaatctttactctaaacatagaaacctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499819
Entry
107499819         CDS       T06036                                 

Gene name
ATP1A1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-1 isoform X1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04911  Insulin secretion
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04964  Proximal tubule bicarbonate reclamation
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray04974  Protein digestion and absorption
ray04976  Bile secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107499819 (ATP1A1)
   04022 cGMP-PKG signaling pathway
    107499819 (ATP1A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107499819 (ATP1A1)
   04918 Thyroid hormone synthesis
    107499819 (ATP1A1)
   04919 Thyroid hormone signaling pathway
    107499819 (ATP1A1)
   04925 Aldosterone synthesis and secretion
    107499819 (ATP1A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107499819 (ATP1A1)
   04261 Adrenergic signaling in cardiomyocytes
    107499819 (ATP1A1)
  09154 Digestive system
   04970 Salivary secretion
    107499819 (ATP1A1)
   04971 Gastric acid secretion
    107499819 (ATP1A1)
   04972 Pancreatic secretion
    107499819 (ATP1A1)
   04976 Bile secretion
    107499819 (ATP1A1)
   04973 Carbohydrate digestion and absorption
    107499819 (ATP1A1)
   04974 Protein digestion and absorption
    107499819 (ATP1A1)
   04978 Mineral absorption
    107499819 (ATP1A1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107499819 (ATP1A1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107499819 (ATP1A1)
   04964 Proximal tubule bicarbonate reclamation
    107499819 (ATP1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107499819 (ATP1A1)
Enzymes [BR:ray01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     107499819 (ATP1A1)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107499819 (ATP1A1)
  Exosomal proteins of other body fluids (saliva and urine)
   107499819 (ATP1A1)
  Exosomal proteins of colorectal cancer cells
   107499819 (ATP1A1)
  Exosomal proteins of bladder cancer cells
   107499819 (ATP1A1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 107499819
NCBI-ProteinID: XP_015979826
LinkDB
Position
Unknown
AA seq 1021 aa
MGKGIGRDKYEPAAVSEHGDKKKAKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLSRG
LTSARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIQAATE
EEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINA
EEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNI
AFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHLITGVAVFL
GVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKSSATWIALS
RIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMREQYAKIVEIPF
NSTNKYQLSIHKNPNTSEPRHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAY
LELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPVENLCFVGLISMIDPPRAAVPDA
VGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKA
CVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDS
PALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTS
NIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTD
KLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGIRVDWDDRWINDVEDSY
GQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEET
ALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRSPGGWVEKETY
Y
NT seq 3066 nt   +upstreamnt  +downstreamnt
atggggaaagggatcggacgtgataaatatgaacccgccgccgtttcagagcatggcgac
aaaaagaaggccaagaaagagagggatatggatgaactgaagaaagaagtttctatggat
gaccataaactcagccttgatgaacttcatcgcaaatacggaacagacttgagccgaggc
ttaaccagtgctcgagccgctgagatcctggcccgcgacggtcccaacgccctcaccccg
cctcccaccactcccgaatgggtcaagttctgtcggcagctgtttggggggttctcgatg
ttactgtggatcggggcgattctttgtttcttggcttacggcatccaagctgctactgaa
gaggaacctcaaaatgataatctgtacctcggcgtggtgctgtctgccgtcgtcatcata
actggctgtttctcctactaccaagaagccaaaagctccaagatcatggaatccttcaaa
aacatggttcctcagcaagccctggtgattcgaaacggcgagaaaatgagcatcaacgca
gaggaagtcgtcgtcggggacctggtggaagtgaagggcggcgaccgcatcccggccgac
ctcaggatcatatctgccaacggctgcaaggtggataactcctccctcaccggcgagtcg
gaaccgcagaccaggtctccggacttcaccaacgaaaacccgctggagaccaggaacatc
gccttcttctccaccaactgcgtggagggaactgcccggggcatcgtcgtgtacactggg
gaccgcacggtgatgggaagaatcgccaccctcgcctctgggctggaagggggccagact
cccatagctgcggaaatcgagcatttcatccacctcatcacgggcgtggctgtgttcctg
ggagtgtccttcttcatcctttccctgatcctcgagtacacctggctcgaggccgtcatc
ttcctcatcggtatcattgtcgccaacgtgccggaaggcttgctggccactgtcacggtg
tgcctgaccctcaccgccaagcgcatggcgaggaaaaactgcttggtgaagaacctggaa
gccgtggagaccctggggtccacgtccaccatctgctccgacaaaacggggactctgacg
cagaaccggatgacagtggcccacatgtggttcgacaatcaaatccatgaagccgacaca
acagagaatcagagtggtgtctcattcgacaagtcatcagccacctggatcgctttgtcc
agaatcgcaggtctttgtaacagggcagtgttccaggcgaaccaggaaaacctacctatc
cttaagcgggccgttgcgggtgatgcctccgagtcggcgctgctgaagtgcattgagctg
tgctgtgggtccgtgaaggagatgagggagcagtacgccaagatcgtggagattcccttc
aactccaccaacaagtaccagctgtccattcacaagaaccccaacacgtctgagccccga
cacctgctggtgatgaaaggtgcgccggagaggatcctggaccgctgcagctccatcctg
ctgcacggcaaggagcagcctctggacgaggagctgaaggacgccttccagaacgcctac
ctggagctgggcggcctcggggagcgagtgctaggcttctgccacctcttcctgccagac
gagcagttccccgagggattccagtttgacaccgatgacgtgaatttccccgtcgaaaac
ctctgcttcgtcgggctcatctccatgattgaccctccgagggctgccgtccccgatgcc
gtgggcaaatgtcggagcgctggaattaaggtcatcatggtcaccggagaccatccgatc
acagccaaagccattgccaaaggcgtgggcatcatctcagagggcaacgagactgtcgaa
gacattgctgcccgcctcaacatcccagtgagccaggtgaaccccagagatgccaaggcc
tgtgtggtccacggaagcgacctgaaggacatgacctccgagcagctggacgacattctc
aagtaccacactgagatcgtgtttgcgaggacctcgccgcagcagaagctcatcatcgtg
gagggctgccagagacagggtgctatcgtagctgtaactggcgacggcgtaaatgactct
ccagctctgaagaaggcggacatcggggtcgctatggggattgctggctcggacgtgtct
aagcaagccgccgacatgattctcttagacgacaacttcgcctccattgtgaccggagta
gaggaaggtcgcctgatcttcgataacttgaagaaatccatcgcctacaccctgaccagt
aacattccagagatcacccccttcctgatatttattattgcaaacattccgctgccgctg
ggcacagtcaccatcctctgcatcgacttgggcacggacatggtccccgccatctccctg
gcttacgagcaagccgagagcgacatcatgaagaggcagccccggaaccccaagacggac
aaactcgtgaacgagcggctcatcagcatggcctacgggcagattggcatgatccaggcc
ctggggggcttcttcacttacttcgtgattctggctgagaacggcttcctccccattcac
ctgctgggcatccgcgtggactgggatgaccgctggatcaacgacgtggaggacagctac
gggcagcagtggacctacgagcagaggaagatcgtggagttcacctgccacacggccttc
ttcgtcagcatcgtggtggtgcagtgggccgacttggtcatctgtaagaccaggaggaac
tctgtcttccagcaggggatgaagaataagatcttaatattcggcctcttcgaagagacg
gcccttgccgctttcctctcctactgccctgggatgggcgtcgccctgaggatgtacccc
ctcaaacctacctggtggttctgtgccttcccgtactctctccttatcttcgtgtacgac
gaagtcaggaaactcatcatcaggcgaagccctggaggctgggtggagaaggagacctac
tattag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502600
Entry
107502600         CDS       T06036                                 

Gene name
ATP1A3
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-3
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04911  Insulin secretion
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04964  Proximal tubule bicarbonate reclamation
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray04974  Protein digestion and absorption
ray04976  Bile secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107502600 (ATP1A3)
   04022 cGMP-PKG signaling pathway
    107502600 (ATP1A3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107502600 (ATP1A3)
   04918 Thyroid hormone synthesis
    107502600 (ATP1A3)
   04919 Thyroid hormone signaling pathway
    107502600 (ATP1A3)
   04925 Aldosterone synthesis and secretion
    107502600 (ATP1A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107502600 (ATP1A3)
   04261 Adrenergic signaling in cardiomyocytes
    107502600 (ATP1A3)
  09154 Digestive system
   04970 Salivary secretion
    107502600 (ATP1A3)
   04971 Gastric acid secretion
    107502600 (ATP1A3)
   04972 Pancreatic secretion
    107502600 (ATP1A3)
   04976 Bile secretion
    107502600 (ATP1A3)
   04973 Carbohydrate digestion and absorption
    107502600 (ATP1A3)
   04974 Protein digestion and absorption
    107502600 (ATP1A3)
   04978 Mineral absorption
    107502600 (ATP1A3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107502600 (ATP1A3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107502600 (ATP1A3)
   04964 Proximal tubule bicarbonate reclamation
    107502600 (ATP1A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107502600 (ATP1A3)
Enzymes [BR:ray01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     107502600 (ATP1A3)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107502600 (ATP1A3)
  Exosomal proteins of other body fluids (saliva and urine)
   107502600 (ATP1A3)
  Exosomal proteins of colorectal cancer cells
   107502600 (ATP1A3)
  Exosomal proteins of bladder cancer cells
   107502600 (ATP1A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 107502600
NCBI-ProteinID: XP_015985445
LinkDB
Position
Unknown
AA seq 1014 aa
MGDKKDDKGSPKKSKGAKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQ
EILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDN
LYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGD
LVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNC
VEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFIL
SLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGS
TSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCN
RAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQ
LSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLG
ERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSA
GIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVGQVNPRDAKACVIHGTD
LKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKAD
IGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITP
FLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERL
ISMAYGQIGMIQALGGFFSYFVILAENGFLPSNLVGIRLNWDDRTVNDLEDSYGQQWTYE
QRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLS
YCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY
NT seq 3045 nt   +upstreamnt  +downstreamnt
atgggggacaagaaagatgacaagggctcgcccaagaagagcaagggcgccaaggagcgc
cgggacctggatgacctcaagaaggaggtggctatgacggagcacaagatgtcagtggaa
gaggtctgccggaaatacaacacggactgcgtgcagggtctgacccacagcaaagcccag
gagatcctggcccgggacgggccaaacgcgctcacgccgccacccaccaccccagagtgg
gtcaagttctgccgccagctcttcgggggcttctccatcctgctgtggatcggggccatc
ctctgcttcctggcctacggcatccaggcgggcacggaggacgatccctctggggacaac
ctgtacctgggcatcgtgctggcagccgtggtcatcatcaccggctgcttctcctactac
caggaagccaagagctccaagatcatggagtctttcaagaacatggttccccagcaagcc
ctggtgatccgggaaggtgagaaaatgcaggtgaacgctgaagaggtggtggttggagac
ttggtggagatcaagggtggagaccgagtcccagccgacctgcgcatcatctcagcccac
ggctgtaaggtagacaactcctccctgactggtgagtcagagccgcagactcgctctcct
gactgcacacacgacaaccccttggagactcgaaatatcaccttcttttccaccaactgt
gtggaaggcacggctcggggtgtggtggtggccacaggggaccgcactgtcatgggccgg
attgccaccctcgcctcagggctggaggtgggcaagacgcccatcgccatcgagatcgag
cacttcatccagctcatcactggcgtggccgtcttcctgggcgtctccttcttcatcctc
tctctcattcttggatatacctggctcgaggctgtcatcttcctcatcggcatcatcgta
gccaatgtcccagagggtctgctagccaccgtcactgtgtgtctgacactgaccgccaag
cgcatggcccggaagaattgcctcgtgaaaaacctggaggctgtggagaccctgggctcc
acgtccaccatctgctcagacaagacagggaccctcacccagaaccgcatgacggttgcc
cacatgtggtttgacaaccagatccacgaggccgacaccactgaggaccagtcagggaca
tcgttcgacaagagctcgcacacctgggtggccctgtcccacatcgccggactctgcaat
cgggccgtcttcaagggcggtcaggacaacatccctgtgctcaagagggatgtggccggt
gatgcctcggagtcggccctgctgaagtgcatcgagttgtcctctgggtctgtgaaactg
atgcgggaacgcaacaagaaagtggccgagattccctttaactccaccaacaaataccag
ctgtccattcacgagactgaggaccccaatgacaaccggtacctgctggtgatgaagggt
gcccccgagcgcatcctggaccgctgctccaccatcctgctgcagggcaaggagcagcca
ttggatgaggagatgaaggaggcctttcagaacgcctacctggaactcggcggcctgggc
gagcgggtgctgggtttctgccattactacctgcctgaggagcaattccccaagggcttt
gccttcgactgtgacgatgtgaacttcaccacggacaacctctgctttgtgggcctcatg
tccatgatcgacccgccccgggcagccgtccccgacgccgtgggcaagtgccgcagcgcg
ggcatcaaggtcatcatggtcacgggcgatcaccccatcacggcaaaggccattgccaag
ggcgtgggcatcatctctgagggtaacgagaccgtggaggacatcgctgcccggctcaac
atccctgtgggacaggtcaaccctcgggacgccaaggcctgtgtgatccatggcaccgac
ctcaaggacttcacctctgagcagatcgacgagatcctgcagaaccacactgagatcgtc
tttgcccgcacgtccccccagcagaagctcatcatcgtggagggctgtcagagacaggga
gctattgtggctgtgactggagacggcgtgaacgactcccctgctctgaagaaggccgac
attggggtggccatgggcatcgccggctctgatgtctccaagcaggcggcggacatgatt
ctgctggacgacaactttgcctctatcgtcacgggtgtggaggagggccgcctgatcttc
gacaacctgaagaagtccatcgcttacaccttgaccagcaacatccccgagatcacaccc
ttcctgctgttcatcatggccaacatcccactgcctctgggcaccatcaccatcctctgc
atcgacctgggcactgacatggtccccgccatctcgttggcatatgaggctgccgagagt
gacatcatgaagagacagcccaggaatccacgcactgacaagctggtcaatgagaggctc
atcagcatggcctacgggcagatcggaatgatccaggctctgggcggcttcttctcctac
ttcgtgatcctggcagaaaatggtttcttgcccagcaacctggtgggcatccggctgaac
tgggatgaccgcactgtcaatgaccttgaggacagttacgggcagcagtggacatacgag
cagaggaaagtggtagagttcacgtgccacacggccttcttcgtgagcatcgtggtcgtc
cagtgggctgacctgatcatctgcaagacgcgcaggaactcagtcttccagcagggcatg
aagaataagatcctgatcttcgggctgtttgaggagacagcccttgctgccttcctgtcg
tactgccctggcatggacgtggcccttcgcatgtaccctctcaagcccagctggtggttc
tgtgccttcccctacagcttcctcatcttcgtctatgatgaaatccgtaaacttatcctg
cgcaggaaccccgggggttgggtggagaaggaaacctactactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505043
Entry
107505043         CDS       T06036                                 

Gene name
FXYD2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit gamma isoform X1
  KO
K01538  sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04911  Insulin secretion
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04964  Proximal tubule bicarbonate reclamation
ray04970  Salivary secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray04974  Protein digestion and absorption
ray04976  Bile secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107505043 (FXYD2)
   04022 cGMP-PKG signaling pathway
    107505043 (FXYD2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107505043 (FXYD2)
   04918 Thyroid hormone synthesis
    107505043 (FXYD2)
   04919 Thyroid hormone signaling pathway
    107505043 (FXYD2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107505043 (FXYD2)
   04261 Adrenergic signaling in cardiomyocytes
    107505043 (FXYD2)
  09154 Digestive system
   04970 Salivary secretion
    107505043 (FXYD2)
   04972 Pancreatic secretion
    107505043 (FXYD2)
   04976 Bile secretion
    107505043 (FXYD2)
   04973 Carbohydrate digestion and absorption
    107505043 (FXYD2)
   04974 Protein digestion and absorption
    107505043 (FXYD2)
   04978 Mineral absorption
    107505043 (FXYD2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107505043 (FXYD2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107505043 (FXYD2)
   04964 Proximal tubule bicarbonate reclamation
    107505043 (FXYD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107505043 (FXYD2)
   04147 Exosome [BR:ray04147]
    107505043 (FXYD2)
Transporters [BR:ray02000]
 Other transporters
  Pores ion channels [TC:1]
   107505043 (FXYD2)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107505043 (FXYD2)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8 DUF4079
Other DBs
NCBI-GeneID: 107505043
NCBI-ProteinID: XP_015990364
LinkDB
Position
Unknown
AA seq 127 aa
MFNVPTSSLATPRLGNLPEAEVVEEGSREEPGLLGRWQGRRQMMQREERTNPWRLRRPHK
QHGFLLWISGGNPKGDVDPFSYDYETVRNGGLIFAALAFVVGLIIILSKRLRCGGKKKHR
QVSEDGL
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtttaatgtccccacctcatccctggccaccccaagactaggcaatctccccgaggca
gaggtggtggaggaaggcagcagagaggaacccggtctgctagggagatggcagggtcgt
cgtcagatgatgcaaagagaagaaagaactaacccctggaggctccggaggccccacaag
cagcatggcttcctgctttggattagtggtggcaaccccaagggggatgtggacccattc
tcctatgactatgagactgtacgcaatgggggactgatcttcgctgccctggccttcgtt
gtggggctcatcataatcctcagcaaaagactccgctgtgggggcaagaagaagcatcgg
caagtcagtgaagatgggctgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507949
Entry
107507949         CDS       T06036                                 

Gene name
ATP1A2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-2 isoform X1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04911  Insulin secretion
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04964  Proximal tubule bicarbonate reclamation
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray04974  Protein digestion and absorption
ray04976  Bile secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107507949 (ATP1A2)
   04022 cGMP-PKG signaling pathway
    107507949 (ATP1A2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107507949 (ATP1A2)
   04918 Thyroid hormone synthesis
    107507949 (ATP1A2)
   04919 Thyroid hormone signaling pathway
    107507949 (ATP1A2)
   04925 Aldosterone synthesis and secretion
    107507949 (ATP1A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107507949 (ATP1A2)
   04261 Adrenergic signaling in cardiomyocytes
    107507949 (ATP1A2)
  09154 Digestive system
   04970 Salivary secretion
    107507949 (ATP1A2)
   04971 Gastric acid secretion
    107507949 (ATP1A2)
   04972 Pancreatic secretion
    107507949 (ATP1A2)
   04976 Bile secretion
    107507949 (ATP1A2)
   04973 Carbohydrate digestion and absorption
    107507949 (ATP1A2)
   04974 Protein digestion and absorption
    107507949 (ATP1A2)
   04978 Mineral absorption
    107507949 (ATP1A2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107507949 (ATP1A2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107507949 (ATP1A2)
   04964 Proximal tubule bicarbonate reclamation
    107507949 (ATP1A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107507949 (ATP1A2)
Enzymes [BR:ray01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     107507949 (ATP1A2)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107507949 (ATP1A2)
  Exosomal proteins of other body fluids (saliva and urine)
   107507949 (ATP1A2)
  Exosomal proteins of colorectal cancer cells
   107507949 (ATP1A2)
  Exosomal proteins of bladder cancer cells
   107507949 (ATP1A2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Sigma70_r4
Other DBs
NCBI-GeneID: 107507949
NCBI-ProteinID: XP_015994901
LinkDB
Position
Unknown
AA seq 1020 aa
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAME
DEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVVREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSSILVQGKEIPLDKEMQDAFQNAYM
ELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKAC
VVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSTNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgggccgtggggctggacgcgagtactctcctgcagccaccactgcggagaatgggggc
ggcaagaagaaacagaaggagaaggagctggatgagctgaaaaaggaggtggccatggat
gatcacaagctgtccttggatgagctgggccgcaaataccaagtggacctgtccaagggc
ctcaccaaccagcgagcccaggacattctggctcgagatggacccaacgccctcactcca
cccccaacaacccctgagtgggtcaagttctgtcgccagcttttcgggggcttctctatc
cttctgtggatcggtgccatcctctgctttctggcctatggtatccaggctgccatggaa
gatgaaccgtccaatgacaatctgtatctgggtgtggtgctggcagctgtggtcatcgtc
actggctgcttctcctactaccaggaggccaagagctccaagatcatggattccttcaag
aatatggtgcctcagcaagccctggtggtgcgggagggcgagaagatgcagatcaatgcg
gaggaggtggtggtaggagacctggtggaagtgaagggtggagaccgcgtgcctgctgac
ctccggatcatctcatctcatggctgtaaggtggacaactcatccctaactggcgagtca
gagccccagacccgctcccctgagttcacccatgagaaccccctggagactcgcaatatc
tgtttcttctctaccaactgtgtggaaggcactgctaggggcatcgtcattgccacaggt
gatcggacggtgatgggccgcatagccactctggcctcaggcctggaagttgggcggacg
cccatagccatggagatcgaacatttcatccagctgatcacaggggtggctgtgtttctg
ggtgtctccttcttcgtgctgtcgctcatcctgggctacagctggctggaggccgtcatc
ttcctcattggcatcatcgtggccaacgtgcctgagggtctcctggccactgtcactgtg
tgtctgaccctgacagccaagcgcatggcaaggaagaactgcctggtgaagaacctggag
gcagtggagacgctgggctccacctccaccatctgctccgacaagacgggcaccctcacc
cagaaccgcatgactgtcgcccacatgtggtttgacaaccagatccatgaggccgatacc
actgaagaccagtctggggccacttttgacaaacgatcccctacatggacagccctatct
cgcatagctggtctctgcaaccgtgcggtcttcaaggccggacaggagaacatttctgtg
tctaagcgggacacagctggtgatgcctctgaatcagccctgctgaagtgcattgagctg
tcctgtggctccgtgaggaagatgagagacagaaaccccaaggtggcagaaattcctttc
aactccaccaacaagtaccagctgtccatacatgagcgagaagacagcccccagagccac
gtgctggtgatgaagggagccccagagcgcatcctggaccggtgttcctccatcttggtg
cagggcaaagagatccctctggacaaggagatgcaagatgcctttcagaatgcctacatg
gagttgggagggctaggggagcgagtgctggggttctgtcaactgaatctgccctctgga
aagtttcctcgcggcttcaaattcgacacagatgagctgaactttcccacggagaagctt
tgtttcgtgggtctcatgtccatgattgaccctccccgggccgctgtgccagatgctgtg
ggcaagtgtcggagtgcaggcatcaaggtgatcatggtgaccggggaccaccctatcaca
gccaaggccattgctaaaggcgtgggcattatatcagagggcaatgagactgtggaggac
attgcagcccggctcaacataccagtcagtcaagtcaacccaagagaggccaaggcgtgt
gtggtgcatggttctgacctgaaggacatgacgtcagagcagctggacgagatcctcaag
aaccacacggagattgtctttgcgcggacatctccgcagcagaagcttatcatcgtggag
gggtgtcagaggcagggagccattgtggcagtgacaggcgatggcgtgaatgattcccct
gcgctgaagaaggcagacatcggcattgccatgggcatctcaggctccgatgtctctaag
caggcagccgacatgatccttctggatgacaactttgcctccatcgttacaggcgtggag
gagggccgcctcatctttgacaacctgaagaaatccatcgcatacaccctgaccagcaac
atccctgagatcacccccttcctgctcttcatcattgccaacatccccctaccactgggc
actgtgaccatcctctgcatcgacctgggcactgacatggtccctgccatctctttggcc
tatgaggcagctgagagtgacatcatgaaacgacagccgaggaactcacagacagacaag
ctggtcaatgagcggctcatcagcatggcttatggacagatcgggatgatccaggcactg
ggtggcttcttcacctatttcgtgatcctggcagagaacggcttcttgccctcacggctg
ctgggaatacgccttgactgggatgaccggtccacgaatgacctggaggacagctatgga
caggagtggacttatgagcagcggaaagtggtggagtttacatgccatacagcctttttt
gccagcattgtggtagtgcagtgggccgacctcatcatctgcaagacccgccgcaactca
gtcttccagcagggcatgaagaacaagattttgatctttgggctcctggaggagacagcg
ctagctgcctttctgtcctactgcccaggcatgggtgtggccctccgcatgtacccgctc
aaggtcacctggtggttctgtgccttcccttacagtctcctcatcttcatctatgatgag
gtccgcaagctcatcctgcgacgatatcctggtggctgggtggaaaaggagacatactac
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507966
Entry
107507966         CDS       T06036                                 

Gene name
ATP1A4
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-4
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04911  Insulin secretion
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04964  Proximal tubule bicarbonate reclamation
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray04974  Protein digestion and absorption
ray04976  Bile secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107507966 (ATP1A4)
   04022 cGMP-PKG signaling pathway
    107507966 (ATP1A4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107507966 (ATP1A4)
   04918 Thyroid hormone synthesis
    107507966 (ATP1A4)
   04919 Thyroid hormone signaling pathway
    107507966 (ATP1A4)
   04925 Aldosterone synthesis and secretion
    107507966 (ATP1A4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107507966 (ATP1A4)
   04261 Adrenergic signaling in cardiomyocytes
    107507966 (ATP1A4)
  09154 Digestive system
   04970 Salivary secretion
    107507966 (ATP1A4)
   04971 Gastric acid secretion
    107507966 (ATP1A4)
   04972 Pancreatic secretion
    107507966 (ATP1A4)
   04976 Bile secretion
    107507966 (ATP1A4)
   04973 Carbohydrate digestion and absorption
    107507966 (ATP1A4)
   04974 Protein digestion and absorption
    107507966 (ATP1A4)
   04978 Mineral absorption
    107507966 (ATP1A4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107507966 (ATP1A4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107507966 (ATP1A4)
   04964 Proximal tubule bicarbonate reclamation
    107507966 (ATP1A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107507966 (ATP1A4)
Enzymes [BR:ray01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     107507966 (ATP1A4)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107507966 (ATP1A4)
  Exosomal proteins of other body fluids (saliva and urine)
   107507966 (ATP1A4)
  Exosomal proteins of colorectal cancer cells
   107507966 (ATP1A4)
  Exosomal proteins of bladder cancer cells
   107507966 (ATP1A4)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 107507966
NCBI-ProteinID: XP_015994921
LinkDB
Position
Unknown
AA seq 1030 aa
MGLGGRKRMAMPREQNPSPKPRRRPKGAKRRVKKKRKKIDVEDLKKEVVLDDHKLTLEQL
STKYSVDLTKGLSSEEAEKILIRDGPNVLTPPPTIPEWVKFCKQLFGGFSILLWTGAILC
FVAYGIQAYFNEEPTKDNLYLGIVLAVVVVITGCFSYSQEAKSSKIMESFKSMVPQQALV
IRGGEKIQIDVQNVVLGDLVEVKGGDRIPADIRLISAQGCKVDNSSLTGESEPQTRSPDF
THENPLETRNICFFSTNCVEGTARGIVIATGDSTIMGRIAILTSGLKVGKTPIAIEIENF
IHLITSVAIFLGVAFFGLSLFLGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRM
VRKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWFDKTIYEADTSGEHIGNTF
DKGSDTWFILAQIAGLCNRADFKANQENLPIAKRETAGDASESALLKFIEQFYSSVKEMR
EKSPKVAEIPFNSTNKYQMSIHLREDSSQAHVLLMKGAPERILGFCSSYLLNGQEYSMDD
EMKEAFQEAYLELGGLGERVLGFCFLNLPNTFSKGFKFNTDELNFPMNDLCFVGLISMID
PPRASVPDAVSKCRSAGVKVIMVTGDHPITAKAIAKGVGIISEGAETVEDIAARLKVPVS
QIDTKDATAIVIHGSQLKDMNSEDLDNILQNHTEIVFARTSPQQKLIIVEGCQRLGAIVA
VTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLK
KSIAYTLTSNIPEITPFLLFIVLGIPLPLGTITILCIDLGTDMVPAISLAYESAESDIMK
RAPRNPKTDNLVNHRLIGMAYGQIGMIQALAGFFTYFVVLAENGFKPLDLLGIRLSWENK
YLNDLEDSYGQQWTFEQRKVLEFTCQTAFFVSIVIVQWADLIICKTRRNSVFQQGMKNKI
LIFGILEETLLAAFLSYTPGMDVALRMYPLKILWWFCASPYSLLIFIYDEIRKLIIRRHP
GGWLERETYY
NT seq 3093 nt   +upstreamnt  +downstreamnt
atgggacttggcggtagaaagagaatggcgatgcctcgtgagcagaatccaagcccaaaa
cctagaaggagaccgaaaggggctaaaagacgtgtgaagaagaaaaggaagaagatagat
gtggaggacctgaagaaagaagtggtcttggacgatcataaattaaccttggaacagcta
agcaccaagtattctgtggacctgacaaagggccttagctccgaagaggcagagaaaatc
ctgattcgagatggacctaatgtgcttaccccaccccctaccattccagaatgggtcaaa
ttctgtaaacaactgttcggtggcttctccatcctcctgtggactggtgccattctctgc
tttgtggcctatggcatccaggcatatttcaatgaggagcctaccaaagacaacctatac
ctaggcattgtactagccgttgtggttgtcatcactggctgcttctcctattctcaggag
gccaagagttccaagattatggagtcttttaagagcatggtgcctcagcaagctctggta
attcgagggggagagaagatacagatcgatgtacaaaatgtggtactgggagatctggta
gaagtgaagggtggagaccggatccctgctgacatccggcttatctctgcacaaggatgc
aaggtggacaactcatctttgactggagaatcagagccccaaacacgctcccctgatttc
acacatgagaaccctctggagacccgaaacatctgcttcttctccaccaattgtgtggaa
ggaacagcccgaggcatcgtgatcgccacaggagactctacaataatgggccgcattgcc
atcctgacatcaggcctgaaagttggcaagacacctattgctatagagattgagaacttc
atccatctgatcacttcagtggccatcttccttggtgttgctttctttgggctctccctt
ttcttgggctacagctggctggaggctgtcattttccttattggcatcattgtggccaat
gtgcctgaggggctgctggccactgtcactgtttgtctgaccctgacagccaagcgcatg
gtgaggaagaactgcctggtgaagaacctggaggcggtggagacactgggctccacctcc
accatctgctccgacaagacgggcaccctcacccagaaccgcatgaccgtcgcccactta
tggttcgataagaccatctatgaggctgataccagcggagaacatattgggaatacattt
gacaaaggctctgatacttggtttatcctggcccaaattgctggcctctgcaaccgggct
gactttaaggctaatcaggagaaccttcccatagctaagcgggaaacagcaggggatgcc
tctgagtcagccctcctcaagttcatcgagcagttctacagttctgtgaaggaaatgaga
gagaaaagccccaaggtggcagagattccctttaattctaccaacaagtaccagatgtcc
atccaccttcgggaagacagctcccaggctcatgtgctgctgatgaagggggctcctgag
aggatcttggggttttgctctagttaccttctgaacgggcaggagtactcaatggacgac
gagatgaaagaagccttccaagaggcctacttggagctgggaggtctaggggaacgcgtg
ctagggttttgcttcttgaatctgcctaacactttctccaagggattcaagtttaataca
gatgaactcaattttcccatgaatgacctttgttttgtggggctcatatccatgatcgac
ccgccccgagcttcagtgcctgatgccgtgagcaagtgtcgcagtgcaggggttaaggtg
attatggtaacaggggatcatcccattacagccaaggccattgccaagggtgtgggcatc
atctcagaaggcgctgagacagtagaggacattgctgcccggctcaaggttcctgtcagc
cagattgataccaaggatgccacagccattgtgattcatggctcacaactgaaggatatg
aactcagaggaccttgataacatcctccaaaaccacacggagattgtgtttgctcgaacc
tcccctcagcagaagctgatcattgtagagggatgtcaaaggctgggagccattgttgcc
gtgacgggggatggtgtgaacgactcccccgcgctgaagaaggcagacattggcattgcc
atgggcatcgctggctccgacgtctctaagcaggcggctgacatgatcctgctggatgac
aactttgcctccattgtcactggcgtggaggagggccgcctcatctttgacaatctgaag
aaatctattgcgtacaccctgaccagcaacatccccgagatcacccccttcctgctcttc
atcgtcctcggcatccccctgcctctgggcaccataactattctctgcattgacctgggc
actgacatggtccctgctatctcgttggcttatgagtcagctgaaagtgacataatgaag
agggctccacggaatccaaagactgataatctagtgaaccatcgtctcatcggcatggcc
tatggacagattgggatgatccaggctctagctggattctttacctactttgtggtcctg
gctgagaatggttttaagcctctagatcttctgggcatccgcctcagttgggaaaataaa
tacctcaatgacctggaagatagctatggacagcaatggacatttgagcagcggaaggtg
ttggagttcacctgccaaacggccttctttgtcagcatcgtgatcgtgcagtgggctgac
ctcatcatctgcaagactcgtcgtaactcagtcttccagcagggcatgaagaacaagatc
ttaatatttgggatcctggaggagacattactggctgcctttctgtcctacactccaggc
atggatgtggccctgagaatgtatccactcaagatattatggtggttctgtgcctctccc
tacagccttcttatctttatctatgatgaaataagaaaactcatcatccgtcgtcatcct
ggaggctggctggaaagggagacgtactactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509410
Entry
107509410         CDS       T06036                                 

Gene name
ATP1B3
Definition
(RefSeq) LOW QUALITY PROTEIN: sodium/potassium-transporting ATPase subunit beta-3
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04911  Insulin secretion
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04964  Proximal tubule bicarbonate reclamation
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray04974  Protein digestion and absorption
ray04976  Bile secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107509410 (ATP1B3)
   04022 cGMP-PKG signaling pathway
    107509410 (ATP1B3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107509410 (ATP1B3)
   04918 Thyroid hormone synthesis
    107509410 (ATP1B3)
   04919 Thyroid hormone signaling pathway
    107509410 (ATP1B3)
   04925 Aldosterone synthesis and secretion
    107509410 (ATP1B3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107509410 (ATP1B3)
   04261 Adrenergic signaling in cardiomyocytes
    107509410 (ATP1B3)
  09154 Digestive system
   04970 Salivary secretion
    107509410 (ATP1B3)
   04971 Gastric acid secretion
    107509410 (ATP1B3)
   04972 Pancreatic secretion
    107509410 (ATP1B3)
   04976 Bile secretion
    107509410 (ATP1B3)
   04973 Carbohydrate digestion and absorption
    107509410 (ATP1B3)
   04974 Protein digestion and absorption
    107509410 (ATP1B3)
   04978 Mineral absorption
    107509410 (ATP1B3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107509410 (ATP1B3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107509410 (ATP1B3)
   04964 Proximal tubule bicarbonate reclamation
    107509410 (ATP1B3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107509410 (ATP1B3)
CD molecules [BR:ray04090]
 Proteins
  107509410 (ATP1B3)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 107509410
NCBI-ProteinID: XP_015997361
LinkDB
Position
Unknown
AA seq 279 aa
MTKKDKKSFNQSLAEWKLFIYNPNTGEFLGRTAKSWGLILLFYQVFYGFLAALFTFTMWA
MLQTLNDEVPKYRDQISSPGLMVFPKPVTALDYSFSISNPESYKGYIEDLKRFLKPYDSE
EQKNLTICPSGTLFEQKGPIYVACRFPLDLLQACSGVNDPEFGYSKGHPCILVKMNRIIG
LKPQGEPRIHCTNIVKDENITLSTYPPNGNIDLKYFPYYGKKLHVRYLQPLVAVQVGIGA
SPTKELTVECKIEGSPNLKNHDDRDKFLGRVVFKITMNA
NT seq 840 nt   +upstreamnt  +downstreamnt
atgacgaagaaagacaagaagtccttcaaccagagcctggccgagtggaagctcttcatc
tacaacccgaacaccggagagttcttggggcgcaccgccaagagctggggtttgatcttg
ctcttctatcaagtcttttatgggttcctggctgcactcttcacattcacaatgtgggct
atgcttcagactctgaacgatgaggttccaaaatatcgtgaccagatttctagtccagga
cttatggtttttccaaaaccagtgactgcattggattattcattcagtatatctaatcca
gagtcctataaagggtacattgaagaccttaagaggtttctaaagccatatgattcagaa
gaacagaagaatctcacaatctgtcccagtggaacactttttgaacagaagggtccaatt
tatgttgcatgtcggttccctcttgacttacttcaagcttgcagtggtgtgaatgatcct
gagtttggctactctaaaggacacccttgtattcttgtgaaaatgaacagaataattgga
ttaaagcctcaaggtgaaccaaggatacactgcactaatattgtaaaggatgaaaatata
actctatcaacttatcctcccaatggaaatatagacttaaaatactttccatattatggg
aaaaaactgcatgtgagatatctccagccattagttgctgtccaggtcggcattggtgct
agtcccacaaaagaattaacagtcgagtgcaagattgaagggtcacccaatctaaaaaac
catgatgatcgtgacaagtttttaggaagagttgtgtttaaaatcacaatgaatgcatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512755
Entry
107512755         CDS       T06036                                 

Gene name
ATP1B1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-1
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04911  Insulin secretion
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04964  Proximal tubule bicarbonate reclamation
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray04974  Protein digestion and absorption
ray04976  Bile secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107512755 (ATP1B1)
   04022 cGMP-PKG signaling pathway
    107512755 (ATP1B1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107512755 (ATP1B1)
   04918 Thyroid hormone synthesis
    107512755 (ATP1B1)
   04919 Thyroid hormone signaling pathway
    107512755 (ATP1B1)
   04925 Aldosterone synthesis and secretion
    107512755 (ATP1B1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107512755 (ATP1B1)
   04261 Adrenergic signaling in cardiomyocytes
    107512755 (ATP1B1)
  09154 Digestive system
   04970 Salivary secretion
    107512755 (ATP1B1)
   04971 Gastric acid secretion
    107512755 (ATP1B1)
   04972 Pancreatic secretion
    107512755 (ATP1B1)
   04976 Bile secretion
    107512755 (ATP1B1)
   04973 Carbohydrate digestion and absorption
    107512755 (ATP1B1)
   04974 Protein digestion and absorption
    107512755 (ATP1B1)
   04978 Mineral absorption
    107512755 (ATP1B1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107512755 (ATP1B1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107512755 (ATP1B1)
   04964 Proximal tubule bicarbonate reclamation
    107512755 (ATP1B1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107512755 (ATP1B1)
CD molecules [BR:ray04090]
 Proteins
  107512755 (ATP1B1)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 107512755
NCBI-ProteinID: XP_016004089
LinkDB
Position
Unknown
AA seq 298 aa
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
ISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPQDPKSYDAYVTNIVRFLEKYKESAQKND
MIFEDCGNVPSEYKERGPYDSDPGERKVCRFKLEWLGNCSGINDESYGYREGKPCVIIKL
NRVLGFKPKPPKNESLEKYNPYVLPVQCTGKRDEDKEKIGNVEYFGLGGYAGFPLQYYPY
YGKLLQPKYLQPLLAVQFTNLTVDTEVRIECKAFGENIGYSEKDRFQGRFDVKIEVKS
NT seq 897 nt   +upstreamnt  +downstreamnt
atggcccgcggcaaagccaaggaggagggcagctggaagaagttcatctggaactcggag
aagaaggagtttctgggcaggaccggtggcagctggtttaagatccttctgttctacgtg
atattctacggctgcctggccggcatcttcatcggaaccatccaggtgatgctgctcacc
atcagcgagttcaagcccacctaccaggaccgcgtggccccaccaggcttgacgcagatt
ccccagatccagaagaccgaaatctccttccgtcctcaagaccccaagagctacgacgcg
tacgtgacgaacattgtcaggttcctggaaaagtacaaagaatccgcccagaagaacgac
atgatcttcgaagactgtggcaatgtgcccagcgagtacaaggagcgagggccctacgac
agcgacccgggcgagcggaaggtctgcaggttcaagctcgagtggctggggaactgctcc
gggatcaacgacgagtcgtacggctacagggagggcaagccgtgtgtcatcatcaagctc
aaccgcgtcctgggcttcaaaccgaagcctcccaagaacgaatccttggagaagtataac
ccctacgtcctgcccgttcagtgcaccggcaagcgcgacgaggacaaggagaagatcggg
aacgtggagtacttcggcctgggcggctacgccggcttcccgctgcagtactacccctac
tacgggaagctgctgcagcccaagtacctgcagcccctgctggccgtgcagttcaccaac
ctcaccgtggacaccgaggtccgcatcgagtgcaaggccttcggggagaacatcgggtac
agcgagaaggaccgcttccagggccgcttcgacgtgaaaatcgaagttaagagctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515690
Entry
107515690         CDS       T06036                                 

Gene name
ATP1B2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-2
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04911  Insulin secretion
ray04918  Thyroid hormone synthesis
ray04919  Thyroid hormone signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04960  Aldosterone-regulated sodium reabsorption
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04964  Proximal tubule bicarbonate reclamation
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04973  Carbohydrate digestion and absorption
ray04974  Protein digestion and absorption
ray04976  Bile secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107515690 (ATP1B2)
   04022 cGMP-PKG signaling pathway
    107515690 (ATP1B2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107515690 (ATP1B2)
   04918 Thyroid hormone synthesis
    107515690 (ATP1B2)
   04919 Thyroid hormone signaling pathway
    107515690 (ATP1B2)
   04925 Aldosterone synthesis and secretion
    107515690 (ATP1B2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107515690 (ATP1B2)
   04261 Adrenergic signaling in cardiomyocytes
    107515690 (ATP1B2)
  09154 Digestive system
   04970 Salivary secretion
    107515690 (ATP1B2)
   04971 Gastric acid secretion
    107515690 (ATP1B2)
   04972 Pancreatic secretion
    107515690 (ATP1B2)
   04976 Bile secretion
    107515690 (ATP1B2)
   04973 Carbohydrate digestion and absorption
    107515690 (ATP1B2)
   04974 Protein digestion and absorption
    107515690 (ATP1B2)
   04978 Mineral absorption
    107515690 (ATP1B2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107515690 (ATP1B2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107515690 (ATP1B2)
   04964 Proximal tubule bicarbonate reclamation
    107515690 (ATP1B2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107515690 (ATP1B2)
CD molecules [BR:ray04090]
 Proteins
  107515690 (ATP1B2)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 107515690
NCBI-ProteinID: XP_016010260
LinkDB
Position
Unknown
AA seq 290 aa
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWDQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFI
KMNRVINFYAGANQSMNVTCVGKRDEDAENLGSFVMFPANGNIDLMYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtcatccagaaagagaagaagagctgcgggcaggtggttgaggagtggaaggagttc
gtgtggaacccgaggacgcaccagttcatgggccgcacagggaccagctgggcttttatc
ctcctcttctaccttgtcttctatggcttcctcacggccatgttcaccctcacaatgtgg
gtgatgctgcagactgtctctgaccatacccccaagtatcaggaccggttggccacacca
ggtttgatgattcgtcccaagactgagaatcttgatgtcattgtcaacattagtgacact
gaaagctgggaccagcatgttcagaagctcaacaagttcttggaaccttacaatgactcc
atccaagcccaaaagaatgatgtctgccgccctgggcgctattatgaacagccagataat
ggagtcctaaactacccgaagcgtgcctgccagttcaaccggacccagctgggtgactgc
tctggcatcggggaccccacccattatggttacagcactgggcaaccctgtgtcttcatc
aagatgaaccgggtcatcaacttctacgcaggagcaaaccagagcatgaatgttacctgt
gtggggaagcgagatgaagatgctgagaatctgggaagctttgttatgttccctgctaat
ggcaacattgacctcatgtacttcccctactatggcaaaaagttccacgtgaactacaca
cagcccctggtggctgttaagttcctgaatgtgaccccaaatgtggaggtgaatgtggaa
tgtcgcatcaatgctgccaacattgctacggacgatgagcgagacaagttcgctggccgt
gtggccttcaaactccgcatcaacaaaacctga

DBGET integrated database retrieval system