KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498727
Entry
107498727         CDS       T06036                                 

Gene name
CCNB1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04115  p53 signaling pathway
ray04218  Cellular senescence
ray04914  Progesterone-mediated oocyte maturation
ray05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107498727 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107498727 (CCNB1)
   04114 Oocyte meiosis
    107498727 (CCNB1)
   04115 p53 signaling pathway
    107498727 (CCNB1)
   04218 Cellular senescence
    107498727 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107498727 (CCNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107498727 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ray03032]
    107498727 (CCNB1)
   03036 Chromosome and associated proteins [BR:ray03036]
    107498727 (CCNB1)
DNA replication proteins [BR:ray03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    107498727 (CCNB1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    107498727 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Trypan_PARP
Other DBs
NCBI-GeneID: 107498727
NCBI-ProteinID: XP_015977680
LinkDB
Position
Unknown
AA seq 438 aa
MAFRVTRNTKINAENKVKINMAGAKRVPVSTAAASKPGLRPRTALGDIGNKVSEQPQAKL
PLKKEAKTLAAGKVIAKKVPKPLEKALEPVPEPVPESAQEPVREPASEPEPESVNKEEKL
SPEPILVDTPSPSPMETSGCAPAEEYLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIY
AYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQ
NNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKLQIRQMEMKILRALNF
SLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFSPSQIAAGAFCLALKI
LDNGEWTLTLQHYLSYTEESLLLVMQHLAKNIVMVNRGLTKHMTIKNKYATAKHAKISTL
AQLNSALVQDLAKAVAKV
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggcgttccgggtcaccaggaacacgaaaattaatgctgaaaacaaggtgaagatcaat
atggcaggcgcaaagcgcgtgcctgtgtccactgctgcagcctccaagccgggcctgaga
ccgaggacagcccttggagacatcggtaacaaagtcagtgaacagccacaggccaaatta
cctctgaaaaaggaagcaaaaactttagctgctggaaaagttattgctaaaaaagtacct
aaacctctggaaaaggcactggagcctgtgcctgagccagtgcctgagtctgcgcaggag
cctgtgcgagagcctgcatcggagccagaacctgagtctgttaacaaagaagaaaaactt
tctcctgagcctatcttggttgatactccctctccaagcccaatggaaacatctggatgt
gcccctgcagaagaatatctgtgtcaggctttctctgatgtaattcttgcagtgaacgat
gtggatgcagaagatggagctgatccaaacctttgtagtgaatatgtaaaagatatctat
gcttatctgaggcaacttgaggaagagcaagcagtcagaccaaaatacttactgggtcgt
gaagtcactggaaacatgagagccatcctaattgattggctagtgcaagttcaaatgaaa
ttcagattactgcaggagaccatgtacatgactgtttccattattgatcggttcatgcag
aataattgtgttcccaagaagatgctgcagctggttggtgtcaccgccatgtttattgca
agcaaatatgaagaaatgtaccctccagaaatcggtgactttgcctttgtgactgacaac
acttacactaagctccaaatcagacagatggaaatgaagattctaagagctttaaatttt
agtctgggtcgccctctacccctgcatttccttcggagagcatccaagattggagaggtt
gatgtggagcaacatactttggccaaatacttgatggaactaacgatgttggactatgat
atggtgcacttttctccttctcagattgcagcgggagctttttgtttagcactgaaaatt
cttgataatggtgaatggacactaactctacagcattacctgtcatatactgaagaatcc
cttcttcttgttatgcaacacctggctaagaatatagtcatggtgaatcgtggacttaca
aagcacatgactatcaagaacaagtatgccacagctaagcatgctaagatcagcactctt
gcacagctgaattctgcactagttcaagatctggccaaggctgtggcaaaagtgtaa

DBGET integrated database retrieval system