KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498788
Entry
107498788         CDS       T06036                                 

Gene name
PKMYT1
Definition
(RefSeq) membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase isoform X1
  KO
K06633  membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107498788 (PKMYT1)
   04114 Oocyte meiosis
    107498788 (PKMYT1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107498788 (PKMYT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107498788 (PKMYT1)
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107498788 (PKMYT1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107498788 (PKMYT1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: Other
  WEE family
   107498788 (PKMYT1)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107498788 (PKMYT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 107498788
NCBI-ProteinID: XP_015977795
LinkDB
Position
Unknown
AA seq 516 aa
MPVPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSQSLPPRPPAKGSIPVSRLFPP
RTPGWHQPQPRRVSFRGEASETLRSPSYDPNRPESFFQQSFQRLGRLGHGSYGEVFKVRS
KEDGRLYAVKRSMSPFRGPKDRARKLAEVGGHEKVGQHPHCVRLERAWEEGGILYLQTEL
CGPSLQQHCETWGTSLPEAQVWGYLRDALLALAHLHSQGLVHLDIKPANIFLGPRGRCKL
GDFGLLVELGASGASEAQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGG
EGWQQLRQGYLPPEFTAGLSSDLRSVLIMMLEPDPKLRATAQALLALPMLRQPRPWSVLW
YMAAEALSRGWALWQALLALLCWLWHGLAHPASWLQSPGLPATPPGSPPCSLLLDSSHSS
NWDDDSIGPSLSPEAVLARAARSTSTPRSRHTLRWVGSGLGVGGQLSDLECHFSLFLLPR
DALDLSDIDSEPPQGSFPSFEPRNLLSLFEDSLGPT
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgcctgtgcccacagagggcaccccgccacccctgagtggcacccccatcccagtccca
gcctacttccgccatgcagaacctggcttctccctcaagaggcccagggggctcagtcaa
agcctcccaccccggccccctgccaagggcagcatccctgtcagccgcctcttccctcct
cggaccccgggctggcaccagccccagcctcggagggtgtcgttccgtggcgaagcctct
gagaccctgcggagccccagttatgacccaaaccgtccagagtccttcttccagcagagt
ttccagaggcttggccgtctgggccatggctcttatggagaagtcttcaaggtgcgctcc
aaggaagatggccggctctatgcagtaaagcgttccatgtcaccattccggggccccaag
gaccgggcccgaaagctggccgaggttggtggccatgagaaggtggggcagcacccacac
tgcgtgcggctggagcgagcctgggaggagggtggcatcctgtacttgcagacggagctg
tgcgggcctagcttgcagcaacactgtgagacctggggcaccagcctgcctgaggcccag
gtctggggctacctgcgggacgccctgctcgctctggcccacctgcacagccaaggtctg
gtccaccttgacatcaagcctgccaacatctttttggggccccggggccgctgcaagctg
ggtgactttgggctgctggtggagctgggtgcatccggagccagtgaggcccaggaggga
gacccccgctacatggcccctgagctgctgcagggctcctacgggacagcggctgacgtg
ttcagtctgggtctcaccatcctggaagtggcatgcaacatggagctgccccatggtggg
gagggctggcaacagctgcgccagggctacctgccccctgagttcactgctggcctgtct
tctgacctgcggtctgtcctcatcatgatgctggagcctgaccccaagctgcgggccaca
gcccaggccctgctggccctgcctatgctcaggcagccgcggccctggagtgtcttgtgg
tacatggctgctgaagccctgagtcgagggtgggccctgtggcaggccctgcttgccttg
ctatgctggctctggcatgggctggctcatcctgccagttggctgcagtccccgggtctg
ccagccaccccacctggctcaccgccctgcagcctcctcctggacagcagccactccagc
aactgggatgatgacagcatagggccctcactctctccagaggccgtcctggccagggct
gccaggagcacctccaccccacggagcaggcacacactgaggtgggtaggatcagggttg
ggggtgggggggcagctttcggatcttgaatgtcatttctctctcttccttttgcccagg
gatgcccttgacctaagtgacattgactctgagcctcctcagggctccttcccctccttt
gagcctcggaaccttctcagcttgtttgaggactcgctgggtccaacctga

DBGET integrated database retrieval system