KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498826
Entry
107498826         CDS       T06036                                 

Gene name
TRPM4
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 4 isoform X1
  KO
K04979  transient receptor potential cation channel subfamily M member 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107498826 (TRPM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107498826 (TRPM4)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   107498826 (TRPM4)
SSDB
Motif
Pfam: LSDAT_euk LSDAT_prok Ion_trans
Other DBs
NCBI-GeneID: 107498826
NCBI-ProteinID: XP_015977874
LinkDB
Position
Unknown
AA seq 1210 aa
MVGAEKEQSWIPKIFKKKTCTTFIVDTTDLGGTLCQCGHLRSAHPSVAVEDAFGAAVVTV
WDSDLHTTEKPTDAFGDLDFLGSGRKASNFLRLSDRTDPATVYNLVTRTWGFRAPNLVVS
VLGGSGAPILQTWLQDLLRSGLVRAAQSTGAWIVTEGLHAGIGRHVGVAVRDHQTASTGG
TKVVAMGVAPWGVVRNREALTNPKGSFPASYPWRGDPEDGVQFPLDYNYSAFFLVDDGTH
GRLGGETSFRLRFESHIAQQKAGVRGTGIDIPVLLLLIDGDEKMLKRIENATQAQLPCLL
VAGSGGAADCLAEILEDTLAPGNGGGRRGDARDRIRRFFPTGDPEVLQAQVERIMTRKEL
LTVYSSEDGPEEFETIVLRALVKACGSSDASAYLDELRLAVAWNRVDIAQSELFRGDIQW
RSVHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPMRLAQLYSAAPSNSLLRSLLDQA
SHGAGTKTPALKPSVEPRLPDVGQVLRMLLGEMCAPRYHSWASEDLRHDQGCKEGHQGHT
ESAQLLLVRARATSDLTLDAVLGQTPWSDLFLWALLLNRAQMALYFWELGSNAVASALGA
CLLLRVLARLESEAEEGARRKDLAAKFEGLGVDLFGKCYRSSEERAARLLLRRCPFWGGA
TCLQLAMQADARAFFAQDGVQSLLTQKWWGEMDSATHIGALVLAFFCPPLIYTNLITFRK
SDEEPTQKDLAFDMDKGLNGEGPVRPAEPAEKTCPGARGQRGYARRWPQFWGAPVTAFVG
NVVSYLLFLLLFARVLLVDFQPSPPGAPELLLYFWAFTLLCEELRQGLGGGWGSLASGAP
GPSPCRTPLRRRLRLYLADTWNQCDLVALAFFLLGVGCRLTPGLYDLGRTVLCLDFMVFT
LRLLHIFTVNKQLGPKIVIVNKMMKDVFFFLFFLGVWLVAYGVATEGLLRPQDQDLPKIL
RRVFYRPYLQIFGQIPQEDMDVALMEHVNCSAKQGFWARPSGAQAGSCVSLYANWLVVLL
LVVFLLVANIVLVNLLIAMFSYTFGKVQGNSDLYWKAQRYSLIREFHSRPALAPPFIIIS
HVRLLLRRFCRHRASLPSSPDIQHFRVHLSKEAERRLLTWESVQKEKFLLARARDKRESD
SERLKRTSQKVDTALKQLRQIREYEQRLKGLEQEVQHCSRVLGWVAEALSRSPLLPPGGP
SPPTPLGPRD
NT seq 3633 nt   +upstreamnt  +downstreamnt
atggtgggtgcggagaaggagcagagctggatccccaagatcttcaagaagaagacatgt
acaacattcatcgtggacaccacagatctgggagggaccttgtgccagtgtgggcatctg
cggagtgcccacccatcagtggctgtggaggatgcgttcggggcagccgtggtgactgtt
tgggacagtgacttgcacaccacggagaagcccactgatgccttcggagacctggacttc
ctgggctctggccgcaaggccagcaatttcctccggctctccgaccgcacggatccagct
accgtttataatctggtcacgcgcacgtggggcttccgggccccgaacctggtggtgtca
gtgttgggggggtcgggggcccccatccttcagacctggctgcaggacctgctgcgaagt
gggctggtgcgggctgcccagagcacaggggcctggattgtcaccgaggggctgcacgca
ggaattggccgacacgttggtgtagctgtgagggaccaccagacggccagcactgggggt
accaaggtagtggccatgggcgtggccccctggggtgtcgtgcggaatagagaagccctc
accaaccccaagggctcgttcccagccagttacccgtggcgcggggaccccgaggatggg
gtccagtttccactcgactataactactcagccttcttcctggtggacgacggtacccat
ggccgcctgggcggtgagaccagcttccgcctgcgctttgagtcccacatcgcccagcag
aaggcgggcgtgagagggaccggcattgacatccctgtcctcctcctcctgattgatggt
gatgagaagatgttgaagcggatagagaatgccacccaggctcagctcccctgcctgctg
gtggccgggtctgggggagctgcggactgcctggctgagatcctggaagacactctggct
ccagggaatggagggggcaggcgaggtgatgctcgagatcggatacggcgtttctttccc
acgggggacccagaggtcctgcaggcccaggtggagaggatcatgacccggaaggagctg
ctgacggtctattcatctgaggatgggcctgaggaatttgagaccatcgttttgagggcc
ctcgtcaaggcctgtgggagctctgacgcctcagcttacctggacgagctgcgtttggct
gtggcttggaaccgtgtggacattgcccagagtgaactcttccggggcgacatccagtgg
cggtccgtccacctggaggcctccctcatggatgccctcctgaacgaccggcccgagttc
gtccgcctgctcatctcccacggcctcagccttggccatttcctgaccccgatgcgcctg
gcacagctctacagcgcagcgccctccaactcgctcctccgcagcctcctggaccaggcg
tcccatggcgcagggaccaaaaccccagcccttaaaccctctgtggagccccgactccct
gacgtggggcaagtgcttcggatgttgctgggagaaatgtgcgcgccgaggtaccactcc
tgggcctccgaggatctccgccacgaccagggctgcaaggaaggccaccagggccacact
gagagcgcgcagctgctcttggtcagggccagggccacgtcggatctcacgctggacgcc
gtcctcgggcagaccccctggagtgacctgttcctctgggcactgctgctgaacagggct
cagatggctttgtacttctgggagttaggatccaacgctgtggcctcagctcttggggcc
tgtttgctgctccgagtgctggcgcgcctggagtctgaggccgaggagggagcgcggagg
aaggacctggcggctaagtttgaagggctgggtgttgacctctttggcaaatgctaccgc
agcagcgaggaacgggctgctcgcctgctcctccgacgctgtccattctgggggggtgcg
acgtgcctccagctagccatgcaggccgacgctcgtgccttctttgctcaggacggggta
cagtctctgctgactcagaagtggtggggggagatggacagcgccacgcacatcggggcc
ctggttctcgccttcttttgcccgcccctcatctacaccaacctcatcaccttcaggaag
tcggatgaggagcccacacagaaggacctggcattcgacatggacaagggcctcaatggg
gagggaccagtcaggccggcagagcccgccgagaagacatgcccgggggcgaggggccag
cgcggctacgcgcgccgctggccgcagttctggggcgcgcctgtgacggccttcgtgggc
aacgtggtgagctacctgctcttcctgctgctgttcgcgcgcgtgctgctcgtagacttc
cagccgtcgcctcccggcgcgcccgagctgctgctctacttctgggccttcaccctgctc
tgcgaggagctccgccagggcctgggcggcggctggggcagcctggcctctggggcgccc
gggccgagcccctgccggaccccgctgcgccgccggctgcgcctctacctcgccgacacc
tggaaccagtgcgacctggtggccctcgccttcttcctcttgggcgtcggctgccggctg
actccgggcctgtatgacctgggccgcacggtcctctgcctcgatttcatggtcttcacg
ctgcgcctgctgcatatcttcacggtcaacaaacagctggggcccaagattgtcatcgtg
aacaagatgatgaaggacgtgttcttcttcctcttctttcttggcgtgtggctggttgcc
tacggggtggctacggaggggctcctcaggccccaggatcaggacctcccgaaaatcctg
cgacgtgtcttctatcggccctacctgcagatcttcgggcagatcccgcaggaggacatg
gacgtggccctcatggaacatgtcaactgctcggcgaaacagggcttctgggcgcgccca
tccggggcccaggcgggctcctgcgtctcgctctatgccaactggctggtagtgctcctc
cttgtcgtcttcctgctcgtggccaacatcgtgctggtcaatttgctcatcgccatgttc
agctacacgtttggcaaagtgcagggcaacagcgacctctattggaaggcgcagcgatac
agcctcatccgggaatttcactcccggcctgcgctggccccgcccttcatcatcatctca
cacgtgcgcctcctcctccggcgattttgcaggcacagggccagcttgccgtcctccccc
gacattcagcattttcgggtccacctctctaaggaagctgagaggaggctgttgacctgg
gagtcggtgcagaaggagaaattcctgctggcgcgcgcgagggacaagcgggaaagcgac
tcggagcgtctgaagcgcacgtcgcagaaggtggacacggcgttgaagcagctgaggcag
atccgcgaatacgagcagcgtctgaaagggctggaacaggaggtccagcactgtagccgc
gtcctgggttgggtggccgaggccctgagccgctctccgttgcttcccccgggggggcct
tcgcccccaacccctcttgggcccagagactga

DBGET integrated database retrieval system