KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498831
Entry
107498831         CDS       T06036                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray01524  Platinum drug resistance
ray04071  Sphingolipid signaling pathway
ray04115  p53 signaling pathway
ray04141  Protein processing in endoplasmic reticulum
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04215  Apoptosis - multiple species
ray04217  Necroptosis
ray04722  Neurotrophin signaling pathway
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05203  Viral carcinogenesis
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107498831 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107498831 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107498831 (BAX)
   04215 Apoptosis - multiple species
    107498831 (BAX)
   04217 Necroptosis
    107498831 (BAX)
   04115 p53 signaling pathway
    107498831 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107498831 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    107498831 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498831 (BAX)
   05202 Transcriptional misregulation in cancer
    107498831 (BAX)
   05203 Viral carcinogenesis
    107498831 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107498831 (BAX)
   05212 Pancreatic cancer
    107498831 (BAX)
   05225 Hepatocellular carcinoma
    107498831 (BAX)
   05226 Gastric cancer
    107498831 (BAX)
   05214 Glioma
    107498831 (BAX)
   05216 Thyroid cancer
    107498831 (BAX)
   05220 Chronic myeloid leukemia
    107498831 (BAX)
   05217 Basal cell carcinoma
    107498831 (BAX)
   05218 Melanoma
    107498831 (BAX)
   05213 Endometrial cancer
    107498831 (BAX)
   05224 Breast cancer
    107498831 (BAX)
   05222 Small cell lung cancer
    107498831 (BAX)
   05223 Non-small cell lung cancer
    107498831 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107498831 (BAX)
   05014 Amyotrophic lateral sclerosis
    107498831 (BAX)
   05016 Huntington disease
    107498831 (BAX)
   05020 Prion disease
    107498831 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    107498831 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107498831 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107498831 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107498831 (BAX)
   05152 Tuberculosis
    107498831 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498831 (BAX)
   05170 Human immunodeficiency virus 1 infection
    107498831 (BAX)
   05161 Hepatitis B
    107498831 (BAX)
   05160 Hepatitis C
    107498831 (BAX)
   05164 Influenza A
    107498831 (BAX)
   05162 Measles
    107498831 (BAX)
   05168 Herpes simplex virus 1 infection
    107498831 (BAX)
   05163 Human cytomegalovirus infection
    107498831 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107498831 (BAX)
   05169 Epstein-Barr virus infection
    107498831 (BAX)
   05165 Human papillomavirus infection
    107498831 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107498831 (BAX)
   01524 Platinum drug resistance
    107498831 (BAX)
   01522 Endocrine resistance
    107498831 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ray03029]
    107498831 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107498831 (BAX)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    107498831 (BAX)
Transporters [BR:ray02000]
 Other transporters
  Pores ion channels [TC:1]
   107498831 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 107498831
NCBI-ProteinID: XP_015977885
LinkDB
Position
Unknown
AA seq 270 aa
MNGRPVEWRHNQFPKGSADRIVTSRRPRPCGAAARGGHFAGRSREMTHAQRDAHVTGGVL
QPPGQTRREAAAGASVMDGSGEQPRDGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPE
LALEPRGPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVASEMFSDG
NFNWGRVVALFYFASKLVLKALCTKVPQLIRTIMGWTLDFLRERLLGWIQDQGGWDGLLS
YFGTPTWQTLTILVTGMLTASLTVIWKKMG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgaatgggcggccggtggaatggcgccacaaccagttcccaaagggaagtgctgatcgg
atagtcacgtctcggcgtccacgaccgtgcggggcagcggcccgcggtggccattttgcg
gggcggtcacgtgagatgacgcacgctcagcgagatgctcacgtgaccgggggcgtgctg
cagccgcccgggcagacccggcgagaggcggcggcgggagcgtcggtgatggacgggtcc
ggggagcaacccagagacggggggcccaccagctctgagcagatcatgaagacaggggcc
cttttacttcagggtttcatccaggatcgagcagggcgaatggggggagagacacctgag
ctggccctggagcccagggggccgcaggatgcctccaccaagaagctcagcgagtgcctc
aaacgcatcggagatgaactggacagtaacatggagctgcagaggatgattgcagctgtg
gacacagattccccccgcgaggtctttttccgagtagcgtccgagatgttttccgatggc
aacttcaactggggccgggttgtcgccctgttctactttgccagcaaactggtgctcaag
gccctgtgcaccaaagtgccccagctgataagaaccatcatgggctggacactggacttc
cttcgagagcggctgctgggctggatccaggaccagggtggttgggacggccttctctcc
tactttgggacacccacgtggcagacattgaccattctcgtgaccggaatgctcactgcc
tcactaaccgttatctggaagaagatgggctga

DBGET integrated database retrieval system