KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498846
Entry
107498846         CDS       T06036                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00600  Sphingolipid metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray05152  Tuberculosis
Module
ray_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107498846 (SPHK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107498846 (SPHK2)
   04371 Apelin signaling pathway
    107498846 (SPHK2)
   04020 Calcium signaling pathway
    107498846 (SPHK2)
   04072 Phospholipase D signaling pathway
    107498846 (SPHK2)
   04071 Sphingolipid signaling pathway
    107498846 (SPHK2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107498846 (SPHK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107498846 (SPHK2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     107498846 (SPHK2)
SSDB
Motif
Pfam: DAGK_cat
Other DBs
NCBI-GeneID: 107498846
NCBI-ProteinID: XP_015977910
LinkDB
Position
Unknown
AA seq 670 aa
MGREPLARLPSPPWRAGGQTDAQRLDQELTWSWGHKPRSALDRAEAMAPLPPPPLAASTP
VLHGEFGSYPARGPRFALTLTPQALHVQRLRPKPEARPRGGLVLLAEVSGCCTLRSRSAS
DSAAYLCIYTYPRGRRRGRHRATRTFRVDGAANYEGNRAEAQRWATALMCLLRGLPLPED
GEITTQLLPRPPRLLLLINPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHAREL
VQGLSLSEWDGIVTVSGDGLLYEVLNGLLERPDWEEAVKTPVGILPCGSGNALAGAVNQH
GGFEPALGIDLLLNCSLLLCRGGGCPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSER
FRALGSARFTLGTVLGLATLHTYCGRLSYLPATVEPVSPTPAHGLPRAKSELTLVPAPVP
PMAHSPLHRSVSDLPLPLPLPLPQPALTSPGSPEPLPILSLNGGGPELAVDWGGAGDVPL
SPDPLLPSPPGSPKAAVLAPITEGSPEMPASSGLLPPTPDGDPVAISTGGPPDHLLPPLG
TPLPPGWVTLEGDFVLILAISPSHLGADLVAAPHARFDDGLVHLCWVRGGISRAALLRLF
LAMERGSHFSLGCPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQVHPGLGTLIT
GPPGCPGRKP
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggggagggaacctctggcgcggctcccatcccctccctggagagcaggcggccagaca
gacgcccagaggctggaccaggagctgacctggagctggggccacaagcctaggagtgcc
ctggacagggctgaggccatggccccactaccacccccaccattggctgccagcacccca
gtcctgcatggcgaatttggctcctacccagcccgaggcccacgcttcgccctcactctc
acaccacaggccctgcacgtgcagcggctgcgcccaaagcctgaagccaggccccggggt
ggcctggtcctgctggccgaggtctcgggctgctgcactctgcggagccgcagcgcctct
gactcggcggcctacctctgcatctacacctacccgaggggccggcgtaggggccgccac
agagccacgcgcaccttccgtgtggatggcgcagccaactatgaagggaaccgtgccgag
gcccagcgctgggccactgccctcatgtgcctactgcggggactgccgctgcctgaggac
ggtgaaatcaccacccagcttttgccaaggccgccccgattgctcctattgatcaatccc
tttggggggcggggcctggcctggcagtggtgtaagaaccatgtgctgccgatgatctct
gaggctgggctgtccttcaacctcatccagacagaacgacagaaccatgcccgggagctt
gtccaggggctgagcctgagcgagtgggatggcatcgtcacagtctcaggagatgggctg
ctatatgaggtgctgaacggactcctagaacgccccgactgggaagaggctgtgaagacg
cccgtgggcatcctcccctgtggctcgggcaacgcattggctggagccgtgaaccagcac
ggggggtttgagccggccctaggcattgacctgctgctcaactgctcgctgttgctctgc
cggggtggcggctgcccgctagacctgctgtctgtgacgctggcctccgggtcccgctgt
ttctccttcctgtctgtggcctggggctttgtgtcagatgtggacatccagagcgagcgc
ttcagggccttgggcagtgcccgcttcacgctgggcacggtcctgggcctcgccacactg
catacctactgcggacgcctctcctacctccctgccactgtggaacccgtctcgcccacc
cctgcccatggcctgccccgggccaagtcagagctgaccctggtcccagctccagtccca
cccatggcgcactcacccctgcatcgctctgtgtctgacctgcccctgcccctgcccctg
cccctgcctcagcctgccctgacctcccctggctcacctgaaccactgcccatcctgtcc
ctcaacggtgggggcccagagctggctgtggactggggtggggctggggatgttccactc
tccccagacccactgctgccctcgccccctggctctcccaaggccgctgtactggcaccc
atcaccgaggggtccccggaaatgccagcatcctctgggctcctgcctcccacccctgac
ggtgacccggtagccatctctactgggggcccaccagaccacctgctgcctcctctgggc
accccactacccccaggctgggtgacgctggagggggactttgtgcttatattggccatc
tcacccagccatctgggggctgacctggtggcagctccccacgcacgctttgacgatgga
ctggtacacctgtgctgggtgcgcggtggcatctcgcgggctgcactgctacgccttttc
ctggccatggaacggggtagccacttcagcctgggctgcccgcaacttgggtatgccgcg
gctcgtgccttccgcctcgagccgctcactcctcgcggagtgctcacggtggacggggag
caggtggagtacgggccgctgcaggcgcaggtgcatccgggccttggaaccttaatcacg
gggcctccgggctgccctgggcggaagccctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501245
Entry
107501245         CDS       T06036                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1 isoform X1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00600  Sphingolipid metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray05152  Tuberculosis
Module
ray_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107501245 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107501245 (SPHK1)
   04371 Apelin signaling pathway
    107501245 (SPHK1)
   04020 Calcium signaling pathway
    107501245 (SPHK1)
   04072 Phospholipase D signaling pathway
    107501245 (SPHK1)
   04071 Sphingolipid signaling pathway
    107501245 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107501245 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107501245 (SPHK1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     107501245 (SPHK1)
SSDB
Motif
Pfam: DAGK_cat
Other DBs
NCBI-GeneID: 107501245
NCBI-ProteinID: XP_015982692
LinkDB
Position
Unknown
AA seq 522 aa
MPERAAPCAWPEDMAGRPSPQGANPDSASAVSSPSDPAAAGNDAGAPTARTPGGEGEPHS
RQREARLGSTDKELKAGTTAEGSTPMALGNPWQREPGVKAMDPAGGPWSLLPRPCRVLVL
LNPRGGKGKALQLFRSHVQPLLAQADVSFTLMLTGECLPERVQGASTAGEPLPPTQPLRL
PTERRNHARELVQSEELGRWDALVVMSGDGVMHEVVNGLMARPDWETAIRKPLCSLPAGS
GNALAASLNHYAGYKQVTNEDLLTNCTQLLCGRLLAPMNLLSLQMASGLRVFSVLSLAWG
FIADVDIESEKFRRLGEMRFTVGTILRLATLRIYRGRLAYLPAERAVSKVPAFPALDRQD
QPGPVDTQLVPLGEPVPPHWTVVPEQDFVLVLALLHSHLGSEMFAAPMGHCAAGTMHLFY
VRAGVSRAMLLRLFLAMEKGRHMDCGCPYLQYVPVAAFRLEPKDGKGMFAVDGELVVSEA
VQGQVHPNYFQMVSGRVEPPAPLEPQPLPSQKPQQTPPPEPL
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgccagagcgtgctgctccctgtgcgtggcccgaggatatggctggacgcccctcacct
cagggagccaaccccgactccgcgagcgctgtctcctctccctcagatccggcagccgca
gggaatgacgcgggtgcccccacagcccggactccgggcggggagggcgagccccacagc
cggcagcgagaggcccgcctgggcagcaccgataaggagctgaaggcaggaaccactgcc
gagggcagcaccccgatggcgctggggaacccctggcagcgcgagccgggggtcaaggct
atggatccagccggtggtccctggagcctgctgccacggccctgccgcgtgctggtgctg
ctcaacccgcgcgggggcaagggcaaggccttgcagctcttccggagccacgtgcagccc
ctcctggcccaggccgatgtctccttcacgctcatgctcacgggtgagtgcctccccgag
cgggtgcagggagcatccactgccggcgaacccctcccccccacacagccgctccgtctc
cccacagagcggcggaaccacgccagggagctggtgcagtcggaggagctgggccgctgg
gatgcgctggtggtcatgtctggagacggggtgatgcatgaggtggtgaatggactcatg
gcgcggccggactgggagaccgccatccggaagccgctgtgcagcctgcccgcgggctcc
gggaacgcgctggcggcctctctgaaccattacgccggctacaaacaggtgaccaacgaa
gacctcctgaccaactgcacccagctgctgtgcggcaggctgctggctcccatgaacctg
ctgtctctgcagatggcctccgggctgcgggtcttctcggtgctcagcctggcttggggc
ttcatcgccgacgtggacatcgagagcgagaagttccggcgcctgggggagatgcgcttc
accgtgggcaccatcctgcgcctggcgaccctgagaatctaccggggccgactggcctac
cttcccgcagaacgggcggtctccaaggtgcccgccttccccgctctggaccggcaggac
cagccgggccccgtggacacccagctcgtgcccttgggggagccagtgccccctcactgg
accgtggtgccggagcaggacttcgtgctggtgttggcgctgctgcactcccacctgggc
agtgagatgtttgccgcacccatgggccactgcgcggccggcacgatgcacctgttctat
gtgcgggcaggcgtgtctcgggccatgctgctgcgcctcttcctggccatggagaagggc
aggcacatggactgtggctgtccctatttgcagtatgtgcccgtggccgccttccgcctg
gagcccaaggacgggaagggcatgttcgccgtggatggggagctggtcgtcagcgaggct
gtgcagggccaggtgcacccaaattacttccagatggtcagcggccgcgtggagccccca
gcccctctggagccacagcccctacccagccagaagcctcagcagacgccgcctccagaa
cccctgtga

DBGET integrated database retrieval system