KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498864
Entry
107498864         CDS       T06036                                 

Gene name
GRIN2D
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor ionotropic, NMDA 2D
  KO
K05212  glutamate receptor ionotropic, NMDA 2D
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04724  Glutamatergic synapse
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05033  Nicotine addiction
ray05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107498864 (GRIN2D)
   04024 cAMP signaling pathway
    107498864 (GRIN2D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107498864 (GRIN2D)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107498864 (GRIN2D)
   04720 Long-term potentiation
    107498864 (GRIN2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107498864 (GRIN2D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107498864 (GRIN2D)
   05014 Amyotrophic lateral sclerosis
    107498864 (GRIN2D)
   05017 Spinocerebellar ataxia
    107498864 (GRIN2D)
   05020 Prion disease
    107498864 (GRIN2D)
   05022 Pathways of neurodegeneration - multiple diseases
    107498864 (GRIN2D)
  09165 Substance dependence
   05030 Cocaine addiction
    107498864 (GRIN2D)
   05031 Amphetamine addiction
    107498864 (GRIN2D)
   05033 Nicotine addiction
    107498864 (GRIN2D)
   05034 Alcoholism
    107498864 (GRIN2D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107498864 (GRIN2D)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107498864 (GRIN2D)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor NMDAR2_C MatE
Other DBs
NCBI-GeneID: 107498864
NCBI-ProteinID: XP_015977967
LinkDB
Position
Unknown
AA seq 1334 aa
MRGAGGPGGPRGPAKMLLLLALACASPFPEEAPGPGGAGGGLGGARPLNVALVFSGPAYA
TEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDDSRA
PAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLEEYD
WTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLSAQLRSVSAQI
RLLFCAREEAEPVFRAAEEAGLTGPGYVWFMVGPQLAGGGGSGTPGEPLLLPGGAPLPAG
LFAVRSAGWRDDLGRRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESLHRY
FMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRFL
QPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKRC
CKGFCIDILKRLAQTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTIN
EERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFI
FEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVLVWA
FFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEKNIR
SNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGSGKV
FATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKLDID
NMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAEAAP
PPAKPPPPPPPQPLPSPAXPAARPAPGPAPFVPXERAAVDRWRRSKAAGXPGAAGLADGF
HRYYGPIEPQGLGVSEARAAPXGGGRRPLSPPAAQPPQKPPPSYFAIVRDKEPAEPPAGA
FPGFPSPPAPPAAAAAXVGPPLCRLAFEDESPPAPARWPRSDPESQPLXGPGAGGAGPAG
ARAAGPGRRPAPPCRAAPPPCPYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYPYA
ERLGPPPGRYWSVDKLGGWRAGSWDYLPPRGGPAAWHCRHCASLELLPPPRHLSCSHDGL
DGGWWAPPPPPWAAGPPPRRRARCGCPRPHPHXPRAPHRVPAAPAPHHHRHRRAAGVWDF
PPPAPTSRSLEDLSSCPRAVPPRRLTGPSRHARRCPHAAHWGPPLPSASHRRHRGGDLGT
RRGSAHFSSLESEV
NT seq 4005 nt   +upstreamnt  +downstreamnt
atgcgcggcgccggtggccccggcggccctcggggccccgctaagatgctgctgttgctg
gcgctggcctgcgccagcccgttcccggaggaggcgccggggccgggcggggccggcggg
ggcctcggtggggcgcggccgctcaacgtggcgctcgtgttctcggggcccgcgtacgcc
accgaggcggctcgcttgggcccggcagtggcggcggccgtgcgcagcccgggcctggac
gtgcggccggtggcactggtgctcaacggctcggacccacgcagcctcgtgctgcagctc
tgcgacctgctgtcggggctgcgcgtgcacggcgtcgtcttcgaggacgattcacgcgcg
cccgccgtcgcacccatcctcgacttcctgtcggcacagacctcgctgcccatcgtggcc
gtgcacggcggggccgcgctcgtgctcacgcccaaggagaagggctccaccttcctacag
ctaggctcgtccacagagcagcagcttcaagtcatcttcgaggtgctggaggagtacgac
tggacatcctttgtagctgtgaccacacgtgcccctggccaccgggccttcctgtcctac
atcgaggtgctgaccgatggcagtctggtgggctgggagcaccgcggggcgctgacgcta
gaccctggggcgggcgaggccgtgctgagcgcccagctccgcagcgtcagcgcgcagatc
cgcctgctcttctgtgctcgcgaggaggccgagccggtgttccgggcggccgaagaggcc
ggcctcactggacccggctacgtctggttcatggtggggccccagctggctggaggcggg
ggctcgggcacccctggggagcccctccttctgccaggaggcgccccgctgccagctggg
ctgttcgcagtgcgctcggctggctggcgggatgacttgggccggcgtgtggcagctggt
gtggctgtggtggctagaggtgcccaggccctgctgcgtgactacggcttcctgcctgag
cttggccatgactgtcgtgcccagaaccgcacacatcgaggggagagtctccacaggtac
ttcatgaacattacgtgggacaaccgggattactccttcaatgaggatggcttcctggtg
aatccctcactggtggtcatctccctcaccagagacaggacttgggaggtggtgggcagc
tgggagcagcagaccctccgcctcaagtacccgctgtggtcccgctatggtcgcttcctg
cagcccgtggatgacacgcagcacctcacagtggccacactggaggagaggcccttcgtc
atcgtggagcccgctgaccccatcagcggcacctgcatcagagactccgtcccctgccgg
agccagctcaaccgtacccacagccctccaccggacgccccgcgcccagaaaagcggtgc
tgcaagggcttctgcatcgacatcctgaagcggctggcgcagaccatcggcttcagctat
gacctctacctggtcaccaacggcaagcacgggaaaaagatcgacggcgtctggaatggc
atgatcggggaggtgttctaccagcgcgcggacatggccatcggctcgctcaccataaac
gaggagcggtccgagatcgtagacttctctgtccccttcgtggagacgggcatcagcgtc
atggtcgcgcgcagcaacggcaccgtgtctccttccgccttccttgagccctacagcccc
gccgtgtgggtgatgatgttcgtcatgtgtctcaccgtggttgccgtcactgttttcatc
ttcgagtacctcagtcccgttggctacaaccgcagcctggccacgggaaagcgccctggc
ggctcaaccttcaccattgggaaatccatctggctgctctgggccctggtgttcaataat
tcggtgcccgtggagaacccccgggggaccaccagcaaaatcatggtgctggtgtgggcc
ttcttcgccgtcatcttcctcgccagctacacagccaacctggccgccttcatgatccag
gaggaatacgtggacaccgtgtctgggctcagtgaccgaaagttccagaggccccaggag
cagtacccgcccctgaagtttgggacggtgcccaacgggtccacggagaagaacatccgc
agcaactaccccgacatgcacagctacatggtgcgctacaaccaaccgcgcgtagaggaa
gcgctcactcagctcaaggcagggaagctggacgccttcatctacgatgcggctgtgctc
aactacatggcccgcaaggatgagggctgcaagctcgtcaccatcggctccggcaaggtc
tttgccaccacgggctatggcatcgccctgcacaagggctcccgctggaagcggcccatc
gacctggcgctgctgcagttcctgggggatgatgagatcgagatgctggagaggctgtgg
ctttccgggatctgccacaatgacaaaatcgaggtgatgagcagcaagctggacatcgac
aatatggcgggtgtcttctacatgctcctggtggccatgggcctctccctgctggtcttc
gcctgggagcacctggtgtactggcgcctgcggcactgcctggggcccacgcaccgcatg
gacttcctgctggccttctccaggggcatgtacagctgctgcagcgccgaggccgccccg
ccgcctgccaagccgccgccgccgccgccgccgcagccgctgcccagcccggcgntaccg
gcggcgcggcccgcgcccggccccgcgcccttcgtgcccngcgagcgcgccgccgtggac
cgctggcgccgctccaaagccgcggggncgccgggggccgcgggcctggccgacggcttc
caccgctactacggccccatcgagccgcagggcctgggcgtgagcgaggcgcgtgcggcg
cccnnggggggcggccggcgcccgctgtccccgccggccgcgcagcccccgcagaagccg
ccgccctcctacttcgccatagtgcgcgacaaggagccggctgagccccccgccggcgcc
ttccccggcttcccgtcgccgcccgcgccccccgccgctgcggccgccngcgtcgggccg
ccgttgtgccgcctggccttcgaggacgagagcccgccggcgcccgcgcgctggccgcgc
tccgaccccgagagccagccgctgnctgggccgggcgcgggcggcgccgggcccgcgggg
gcgcgggcggcggggcccggccggcgccccgccccgccgtgccgcgccgcgccgccccct
tgcccgtacctcgacctcgagccgtcgccgtcggactcggaggactcggagagcctgggc
ggcgcgtcgttgggcggcctggagccctggtggttcgccgacttcccctacccatacgcc
gaacgcctcgggccgccgcccggccgctactggtcggtcgacaagctcgggggatggcgc
gctggcagctgggactacctgcccccgcgcggcggcccggccgcctggcactgccgccac
tgcgccagcctggagctgctgccaccgccgcgccacctcagctgctcgcatgacggcctg
gacggcggctggtgggcgccgccgcccccgccctgggccgcggggcccccaccccggcgc
cgggcccgctgcgggtgcccgcggccgcacccgcacncgccgcgggctccgcaccgcgtg
cccgccgcgccggccccgcaccaccaccggcaccggcgcgccgcgggggtctgggacttc
ccgccgcccgcgcccacctcccgctcgctcgaggacctcagctcttgtccccgcgccgtg
cccccacgccggctcaccgggccttcccgccacgcgcgccggtgcccgcacgccgcacac
tggggaccgccgctgccctccgcgtcccaccggagacaccggggcggggacctggggacc
cgccggggctcggcacacttctccagcctcgagtccgaggtatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499583
Entry
107499583         CDS       T06036                                 

Gene name
GRIN3A
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 3A isoform X1
  KO
K05213  glutamate receptor ionotropic, NMDA 3A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04724  Glutamatergic synapse
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05033  Nicotine addiction
ray05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107499583 (GRIN3A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107499583 (GRIN3A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107499583 (GRIN3A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107499583 (GRIN3A)
   05020 Prion disease
    107499583 (GRIN3A)
  09165 Substance dependence
   05030 Cocaine addiction
    107499583 (GRIN3A)
   05031 Amphetamine addiction
    107499583 (GRIN3A)
   05033 Nicotine addiction
    107499583 (GRIN3A)
   05034 Alcoholism
    107499583 (GRIN3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107499583 (GRIN3A)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107499583 (GRIN3A)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor DUF5446
Other DBs
NCBI-GeneID: 107499583
NCBI-ProteinID: XP_015979385
LinkDB
Position
Unknown
AA seq 1121 aa
MRRLSFWWLLSRVCLLLPPPCALVLARVPGSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
APRAASRAPDSSRAGAQRDEPEPGTWRPPASSAGARWLGSALHGRGPPGARKPGEGAGAE
TLWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQNQGEMMELDLVSSVLHIPVISIVRQEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSIINITAN
LSSTENLFSFLQIQIDSIKNSTPTMVMFGCNMRSIRRIFQIITQFGVMPPELHWVLGDSQ
NVEELRTEGLPLGLVAHGKTTQSVFEYYVQDAMELVARAVATATMIQPELALIPSTMNCM
DVDTTNLTSGQYLSRFLANTTFRGLSGSIRVKGSSIISSENNFFIWNLQHDPMGKPMWTR
LGSWQGGKVVVDYGIWPEQAQRHKTHFQHPRKLHLRVVTLIEHPFVFTREVDDEGLCPAG
QLCLDPMTNDSSILDSLFSSLHSSNDSVPIKLKKCCYGYCIDLLEKLAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGDLLTGSAHMAVTSFSINTARSQVIDFTGPFFSTSLGILVRTR
DTAAPIGAFMWPLHWTLWLGIFVALHITAVFLTLYEWKSPFGMTPKGRNRSRVFSFSSAL
NVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATLDGVQYLKNDPEKLD
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFM
DVLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHVVYRLLL
PRIKNKSRLQYWLHTSQRLHRALNTSFVEEKQPRFKTKRVEKRSIVGPRRLAVWNTSNLS
HDNRRKYIFSDEGGQNQLGTGTHQDIPLPPRRRELPASLTTNGRADSLNGARNSVMQELS
ELEKQIQVIRQELQLAVRRKTELEEYQRTNQTLLSAAPQSM
NT seq 3366 nt   +upstreamnt  +downstreamnt
atgaggagactgagtttctggtggctgctgagcagggtctgtctactactgccgccgccc
tgcgcactggtgctggccagggtgcctggctcctcctcgcacccgcagccctgccagatc
ctcaagcgcatcgggcacgcggtgagggtgggtgcggtgcacttgcagccctggaccacg
gccccccgcgcggccagccgcgctccggacagcagccgggcgggcgcccagcgggatgag
cccgagccagggacttggaggcccccggcgtcctcggccggcgctcgctggttggggagc
gccttgcatggccgggggccgccaggcgcccgcaagcccggagagggcgccggggctgag
accctttggcctcgggacgccctcctcttcgccgtggacaacctgaaccgcgtagaaggg
ctgctgccctacaacttgtctttggaagtagtgatggccatcgaggcgggcctgggcgat
ctgccgctcttgcccttctcctcccctagctcgccgtggagcagtgaccctttctccttt
ctgcagagcgtgtgccacactgtggtggtgcaaggggtatcggcactgctcgccttccct
cagaaccagggcgagatgatggagcttgacttggtcagctccgtcctgcacatcccagtg
atcagcatcgtgcgacaagagtttccgcgagagagtcagaatccccttcacctacaactg
agtttagaaaattcattaagttctgatgctgatgtcactgtctcaatcctgaccatgaac
aactggtacaattttagcttgttgctgtgccaggaagactggaatatcactgacttcctc
ctcctcacccagaataattccaagttccacctcgggtctatcatcaacatcactgccaat
ctgtcctccaccgagaacctcttcagcttcctgcagatccagatcgacagcattaagaac
agcacacccacaatggtgatgtttggctgcaacatgagaagtatccggaggattttccag
attatcacccagtttggagtaatgccccctgagcttcattgggtgctgggggattcccag
aatgtcgaggaactgaggacagaaggtctgcccttagggctcgttgctcatggaaaaaca
acacagtcagtctttgagtactatgtacaagatgccatggaactggtcgcaagagctgta
gccacagccactatgatccagccagagcttgctctcatccccagcacaatgaactgcatg
gatgtggatactaccaatctcacttcaggacaatatctatcaaggtttctagccaacacc
acttttagaggcctcagtggttccatcagagtaaaaggttcctctatcatcagctcagaa
aacaactttttcatctggaatctgcaacatgaccccatgggaaagccaatgtggacccgc
ttgggcagctggcagggtggaaaggttgtagtggactatggaatatggccggagcaggcc
cagaggcacaaaacccacttccagcacccacgtaaactgcacctgagagtggttaccctg
attgagcatccattcgtcttcacacgagaggtagatgatgaaggcttgtgccctgctggc
caactctgcctagatcccatgactaatgactcttctatactggacagcctttttagtagt
ctccatagcagtaatgattcagtgcccatcaaactcaagaagtgctgctatggatattgc
attgacctgctggaaaagctagcagaagacatgaactttgattttgacctctatattgtt
ggggatggaaagtatggagcctggaaaaatgggcactggactggactggtaggtgatctc
ctgactgggtcagcccacatggcagtcacttccttcagcatcaatactgcacgaagccag
gtgatagatttcaccggtcctttcttctccaccagcttgggcatcttagtgaggacccgg
gacacagcagctcccattggggccttcatgtggccactccactggacattgtggctgggg
attttcgtggctctgcacatcactgccgtctttctcactctgtatgaatggaagagcccc
tttggtatgactcccaaggggcggaatagaagtagagtcttctccttctcttcagccttg
aatgtgtgttatgccctcttgtttggtagaacagcagccatcaaacccccaaaatgttgg
actggaagatttctgatgaatctttgggccattttttgtatgttttgcctttctacatat
acggcaaacttggctgctgtcatggtaggtgagaagatctatgaagagctttctggaata
catgaccctaagctacatcatccctcccaaggcttccgctttggaactgtccgggaaagc
agcgctgaagattatgtgaggcaaagcttcccagagatgcatgagtacatgagaaggtac
aatgtaccagccacactcgatggagtgcagtatctgaagaatgatccagagaaactagac
gccttcatcatggacaaagcccttctggattatgaagtgtcaatagatgctgactgcaaa
cttcttaccgtggggaagccgtttgccatagaaggctatggcattggtctcccacccaac
tctccattgacctccaacatatcggaactaatcagtcaatacaagtcacatgggtttatg
gatgtgctgcatgacaagtggtacaaagtggttccctgtggcaagagaagtttcgctgtc
actgagacgttacaaatgggcatcaaacacttctctggactcttcgtgctgctgtgcatc
ggatttggtctatccatcttgacaaccattggtgagcacgtagtgtacaggctgctgcta
ccacgaatcaagaacaaatctaggctgcaatactggctccacaccagtcagagattacat
agagcactaaacacatcatttgtagaggaaaagcagccacgtttcaagactaaacgtgtg
gaaaagaggtccattgtgggaccccgtcggcttgccgtgtggaatacttccaatctgagt
catgacaaccgacgaaaatacatcttcagtgatgagggagggcaaaaccagctgggcacc
gggacccaccaggacatccctctccctccaaggagaagagaactccctgcctcactgacc
accaacgggagagctgactccctaaacggagctcggaactcagtgatgcaggagctctca
gagctcgagaagcagatccaggtgatccgtcaggagctgcagctggctgtgcgcaggaaa
acggagctggaagagtatcaaaggacaaaccagactttactctctgcagcaccccaatcc
atgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500897
Entry
107500897         CDS       T06036                                 

Gene name
GRIN3B
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 3B
  KO
K05214  glutamate receptor ionotropic, NMDA 3B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04724  Glutamatergic synapse
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05033  Nicotine addiction
ray05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107500897 (GRIN3B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107500897 (GRIN3B)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107500897 (GRIN3B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107500897 (GRIN3B)
   05020 Prion disease
    107500897 (GRIN3B)
  09165 Substance dependence
   05030 Cocaine addiction
    107500897 (GRIN3B)
   05031 Amphetamine addiction
    107500897 (GRIN3B)
   05033 Nicotine addiction
    107500897 (GRIN3B)
   05034 Alcoholism
    107500897 (GRIN3B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107500897 (GRIN3B)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107500897 (GRIN3B)
SSDB
Motif
Pfam: Lig_chan-Glu_bd Lig_chan SBP_bac_3 ANF_receptor CbiG_mid
Other DBs
NCBI-GeneID: 107500897
NCBI-ProteinID: XP_015982076
LinkDB
Position
Unknown
AA seq 1024 aa
MEFVRMLWLGLALALGPRPAGGHPQPCGVLARLGASVRLGVLLPRAPAARARARAALLPP
LPYNLSLELVDVAPPARDPASLARGLCRTLEAPGVVAVLAFPEARPELLQLHFLAAATET
PVLSVLRREARTPLGAPNPFHLQLHWASPLETLLDVLVSVLEAHAWEDAGLALCRVRDPG
GLVALWTSRAGRAPKVVLDLSRLDVGDAGLQARLAPLGVRAGGSAPVSVAVLLGCEVAAA
RRVLEAAPRGPSWLLGTPLPAEALPTEGLPPGLLALGEVAPPPLEATIHDAVELVARALG
SAARTQPEHAFLPATASCQDPQPGGPKATGRLLARFLGNTSFEGRTGPVWVTSSSQVHVA
RRFRVWSLRHDPLGAPAWATLGSWRDGRLELEPGVAAVRPRAPQGAGARAKLRVVTLVEH
PFVFTREPDEDGQCPAGQLCLAPGTNDSATLDALFAALANGSAPRALRSCCYGYCIDLLE
RLAEDMAFSFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQVVDFS
SPFFSTSLGIMVRARDTASPLGAFTWPLHWSMWLGVFAALHLTALFLTLYEWRSPYGLTP
RGRNRDTVFSCSSALTLCYAILFGRTVSSKTPKCPAGRLLMNLWAIFCLLVLSSYTADLA
AVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVRESSAEAYIKKSFPEMHAHMRRHSAPTT
PRGVAMLTSDPPKLNAFIMDKALLDYEVSIDADCRLLTVGKPFAIEGYGIGLPQNSPLTS
ILSEFISRYKSSGFMDLLHDKWYKMVPCGKRVFAVTETLQMGVCHFSGLFVLLGLGLASA
LLGSLGELVCYHVALPRIRRADGLQYWLHTSQRIHRALNTERPDAQEPELRRPEEQEDTP
VAPAGPGGWTRVRRAVVRGRRVRFLLEPAVAAAAPTGDADAEEAGPTEGPAWLCSNGQPP
AAHGLTGELEELERHIASTRARLRRALLRRGELLTQLRGRTDDRPLRLLQTRREATAPAA
STGS
NT seq 3075 nt   +upstreamnt  +downstreamnt
atggagtttgtgcggatgctgtggctcggcctggcgctggcgctggggcccaggcccgcc
gggggccacccgcagccatgcggcgtcctggcgcgcctgggggcttcggtccgcttgggc
gtcctcctgccccgcgcgcccgccgcccgcgcccgcgcgcgcgcagccctgctgccgccg
ttgccgtacaatctgagcctggagctggtggacgtcgcgccccccgcccgcgaccccgct
tcgctggcccgcggcctgtgccggacgctggaggcgccaggggtggtggcggtgctcgct
ttccccgaggcgcggccggagctgctgcagctgcacttcttagcggccgcgaccgagacc
cccgtgctcagcgtgctgcggcgggaggcgcgcacgcccctcggcgccccgaacccattc
cacctgcagctgcactgggccagccccctggagacgctgctggacgtgctggtgtctgtg
ctggaggcgcatgcctgggaagacgccggcctggcgctctgccgtgtgcgggaccccggc
ggcctggtggccctctggacaagtcgggccggccgggcccccaaggtcgtgctggacctg
agccggctggacgtgggggacgcagggctgcaggcccgcctggccccgctgggggtgcgg
gccgggggctcggccccggtgtccgtggccgtgctgctcggatgcgaagtggccgccgcc
cgtcgggtgctggaggctgcgccccgtgggcccagctggctgctgggcacgccgctgcct
gctgaggcgctgcccaccgagggcctgccgcccgggctgctggcactgggcgaggtggct
ccaccgcctctggaggccaccatccacgatgcggtggagctggtggcccgggcgctgggc
agtgcggcccgcacgcagccggagcacgccttcctgcctgccacggccagctgccaggac
ccgcagccgggcgggcccaaggccaccggccgcctcttggcccggttcctaggcaacacg
tccttcgagggccgcacggggccagtgtgggtgaccagctcctcacaggtgcacgtggcc
cggcgcttccgggtgtggagcctgcgccatgaccctctgggcgccccggcctgggccacc
ctgggcagctggcgggacgggcggctggagctggagccaggggtcgccgccgtgcggccc
cgagccccacagggagccggggcgcgggccaagctgcgcgtggtgacgctggtggagcac
ccgtttgtgttcacccgcgagccggacgaggacgggcagtgcccggccgggcagctgtgc
ctggcgcccggcaccaacgactcggccacgctggacgcgctgtttgccgcgctggccaac
ggctcggcgccccgcgccctgcgcagctgctgctacggctactgcatcgacctgctcgag
cgcctggcggaggacatggccttcagcttcgagctgtacatcgtgggtgacggcaagtac
ggcgccctgcgggacggccgctggaccggcctggtgggcgacctgctggccggccgggcc
cacatggcggtcaccagcttcagcatcaactcggcccgctcgcaggtggtggacttcagc
agccccttcttctccaccagcctgggcatcatggtgcgggcgcgggacacggcctcgccc
ctcggcgccttcacgtggccgctgcactggtccatgtggctgggcgtcttcgcggccctg
cacctcacggcgctcttcctcacgctgtacgagtggcgcagcccctacggcctgacgccc
cgcggccggaaccgcgacaccgtcttctcctgctcctcggccctcaccctctgctacgcc
atactgttcgggcgcacggtgtccagcaagacgcccaagtgccctgcgggccgtctgctc
atgaacctgtgggccatcttctgcctgctcgtgctgtccagctacacggccgacctggcc
gccgtcatggtcggggacaagactttcgaggagctgtcggggatccacgaccccaagctg
caccacccgtcccagggcttccgcttcggcaccgtgcgggagagcagcgccgaggcctac
atcaagaagagcttccccgagatgcacgcgcacatgcggcgccacagcgcgcccaccacg
ccccgcggcgtcgccatgctcacgagcgaccccccaaagctcaacgccttcatcatggac
aaggcgctcctggactacgaggtctccatcgacgccgactgcagactgctcaccgtgggc
aagcccttcgccatcgagggctacggcatcggactgccgcagaactcgccgctcacctcc
atcctgtcggagttcatcagccgctacaagtcctctggcttcatggacctgctgcatgac
aagtggtacaagatggtgccttgcgggaagcgtgtgtttgccgtcacagagaccctgcag
atgggcgtctgccacttctccgggctcttcgtgctgctcggcctgggcctggccagcgcc
ctgcttggctcgctgggcgagctcgtctgctaccacgtggcgctgcctcgcatccgaagg
gccgacgggctgcagtactggctgcacacgagccagagaatccaccgtgccctcaacacg
gagcggcccgatgcgcaggagcccgaactgaggcgtccggaggaacaagaggacacgcca
gtcgcccctgcggggcccggaggctggacacgggtgcggcgggctgtggtaagggggcgt
cgcgtgcgctttctgctggagccggccgtggccgctgctgcacccaccggggacgcggac
gcggaggaggctgggccgaccgagggccccgcctggctctgctccaacggccagccgccc
gctgcccacgggctcacgggggagctggaggagctggagcggcacattgctagcacgagg
gcgcggctccgtcgagcgctgctgcggcgcggggaactcctgacccagctccgaggccgc
accgacgatcggccgctgcgcctgctccagacccgccgggaagcgactgctcctgccgcc
tccacaggcagctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503090
Entry
107503090         CDS       T06036                                 

Gene name
GRIN1
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 1 isoform X1
  KO
K05208  glutamate receptor ionotropic, NMDA 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04724  Glutamatergic synapse
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05033  Nicotine addiction
ray05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107503090 (GRIN1)
   04015 Rap1 signaling pathway
    107503090 (GRIN1)
   04020 Calcium signaling pathway
    107503090 (GRIN1)
   04024 cAMP signaling pathway
    107503090 (GRIN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107503090 (GRIN1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107503090 (GRIN1)
   04720 Long-term potentiation
    107503090 (GRIN1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107503090 (GRIN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107503090 (GRIN1)
   05014 Amyotrophic lateral sclerosis
    107503090 (GRIN1)
   05016 Huntington disease
    107503090 (GRIN1)
   05017 Spinocerebellar ataxia
    107503090 (GRIN1)
   05020 Prion disease
    107503090 (GRIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    107503090 (GRIN1)
  09165 Substance dependence
   05030 Cocaine addiction
    107503090 (GRIN1)
   05031 Amphetamine addiction
    107503090 (GRIN1)
   05033 Nicotine addiction
    107503090 (GRIN1)
   05034 Alcoholism
    107503090 (GRIN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107503090 (GRIN1)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107503090 (GRIN1)
SSDB
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 CaM_bdg_C0 Ion_trans_2
Other DBs
NCBI-GeneID: 107503090
NCBI-ProteinID: XP_015986447
LinkDB
Position
Unknown
AA seq 959 aa
MSTMRLLTLALLFSCSFARAACDPKIVNIGAVLSTRKHEQVFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRL
ETLLEERESKSKKRNYENLDQLSYDNKRGPKAEKVLQFDPGTKNVTALLMEARELEARVI
ILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVE
FNEDGDRKFANYSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLK
IVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSARHTVPQCCYGFC
IDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTI
NNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYL
LDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVEL
STMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKAT
FRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAVEREEGQLQMCARHRES
NT seq 2880 nt   +upstreamnt  +downstreamnt
atgagcaccatgcgcctgctgacattagccctgcttttctcctgctccttcgcccgtgcc
gcctgcgaccccaagatcgtcaacatcggcgcggtgctgagcacgcggaagcacgagcag
gtgttccgcgaggccgtgaaccaggccaacaagcggcatggctcctggaagatccagctc
aatgccacctccgtcacccacaagcccaacgccatccagatggccctgtcggtgtgcgag
gacctcatctccagccaggtctacgcaatcctcgtcagtcacccgcccacccccaatgac
cacttcactcccacccccgtctcctacacagctggcttctaccgcatccctgtcctgggg
ctgaccacccgcatgtccatctactcagacaagagcatccacctgagcttcctgcgcacc
gtgccgccctactcccaccagtcgagcgtctggttcgagatgatgcgcgtctacagctgg
aaccacatcatcctcctggtcagcgacgaccacgagggccgcgcggcacagaagcgcctg
gagacgctgctggaggagcgcgagtccaagagtaaaaaaaggaactatgaaaacctcgac
caactgtcctatgacaacaagcgcggacccaaggctgagaaggtgctgcagttcgacccg
gggaccaagaatgtgacggccctgctgatggaggcgcgggagctggaggcccgggtgatc
atcctctctgccagcgaggacgacgctgccaccgtgtaccgcgcagccgcgatgctgaac
atgacggggtcggggtacgtgtggctggtgggggagcgcgagatctcggggaacgcgctg
cgctacgccccggacggcatcatcgggctgcagctcatcaacggcaagaacgagtcggcc
cacatcagcgacgcggtgggcgtggtggcgcaggccgtgcacgagctcctggagaaggag
aacatcacggacccgccgcggggctgcgtgggcaacaccaacatctggaagaccggaccg
ctcttcaagagagtgctgatgtcctccaagtacgcggacggggtgactggccgtgtggag
ttcaacgaggacggggaccgtaagtttgccaactacagcatcatgaacctgcagaaccgc
aagctggtgcaagtgggcatctacaatggcacccacgtcatccccaatgacaggaagatc
atctggccaggcggagagacagagaagccccgagggtaccagatgtccaccaggctgaag
atcgtgacgatccaccaggagcccttcgtatatgtcaagcccacgctgagtgatggcacg
tgtaaggaggagttcacggtcaacggggaccccgtcaagaaagtgatctgcaccgggccc
aacgacacgtctccgggcagcgcccgccacacggtgcctcagtgctgctacggcttctgc
atcgacctgctcatcaagctggcgcggaccatgaacttcacgtacgaggtgcacctggtg
gccgatggcaagttcggcacgcaggagcgggtgaacaacagcaataagaaggagtggaac
gggatgatgggcgagctgctcagcggccaggcggacatgatcgtggcgccgctgaccatc
aacaacgaacgcgcacagtacatcgagttctccaagcccttcaagtaccagggcctgacc
attctggtcaagaaggagatcccccggagcacgctggactcgttcatgcagcccttccag
agcactctgtggctgctggtggggctgtcggtgcacgtggtggccgtgatgctgtacctg
ctggaccgcttcagccccttcggccggttcaaggtgaacagcgaggaggaggaggaggac
gcgctgacactgtcttcggccatgtggttctcctggggtgtcctgctcaactccggcatc
ggagaaggcgccccccgcagcttctcggcgcgcatcctgggcatggtgtgggccggcttc
gccatgatcatcgtggcctcctacaccgccaacctggcggccttcctggtgctggaccgg
cccgaggagcgcatcaccggcatcaatgatccgcggctgaggaacccctcggacaagttc
atctatgcgacggtaaagcagagctcggtggacatctacttccggcggcaagtggaactg
agcaccatgtaccggcatatggagaaacacaactacgagagcgcggccgaggccatccag
gccgtgcgcgacaacaaactgcacgccttcatttgggactcagcggtactggagtttgag
gcctcgcagaagtgcgacctggtgaccacaggcgagctgttcttccgctctggcttcggc
attggtatgcgcaaggacagcccctggaagcagaacgtgtccctgtccatcctcaagtcc
catgagaacggcttcatggaggacctggacaagacgtgggtgcggtaccaggagtgtgac
tcacgcagcaatgcccctgccactcttacctttgagaacatggcaggggtcttcatgctg
gtggctgggggcattgtggctggcatcttcctgatcttcatcgagattgcctacaagcgg
cacaaggacgcgcgccggaagcagatgcagctcgccttcgcagcggtgaacgtgtggcgg
aagaacctgcaggatagaaagagtggtagagcagagcccgaccctaaaaagaaagccaca
tttagggctatcacctccaccctggcttccagcttcaagagacgtaggtcctccaaagac
acgagcaccgggggtggacgcggcgctttgcaaaaccaaaaagacacagtgctgccgcga
cgcgctgttgagagggaggagggccagctgcagatgtgtgcccgtcatagggagagctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503801
Entry
107503801         CDS       T06036                                 

Gene name
GRIN2C
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor ionotropic, NMDA 2C
  KO
K05211  glutamate receptor ionotropic, NMDA 2C
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04724  Glutamatergic synapse
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05033  Nicotine addiction
ray05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107503801 (GRIN2C)
   04024 cAMP signaling pathway
    107503801 (GRIN2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107503801 (GRIN2C)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107503801 (GRIN2C)
   04720 Long-term potentiation
    107503801 (GRIN2C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107503801 (GRIN2C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107503801 (GRIN2C)
   05014 Amyotrophic lateral sclerosis
    107503801 (GRIN2C)
   05017 Spinocerebellar ataxia
    107503801 (GRIN2C)
   05020 Prion disease
    107503801 (GRIN2C)
   05022 Pathways of neurodegeneration - multiple diseases
    107503801 (GRIN2C)
  09165 Substance dependence
   05030 Cocaine addiction
    107503801 (GRIN2C)
   05031 Amphetamine addiction
    107503801 (GRIN2C)
   05033 Nicotine addiction
    107503801 (GRIN2C)
   05034 Alcoholism
    107503801 (GRIN2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107503801 (GRIN2C)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107503801 (GRIN2C)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor NMDAR2_C
Other DBs
NCBI-GeneID: 107503801
NCBI-ProteinID: XP_015988064
LinkDB
Position
Unknown
AA seq 1248 aa
MFSLCASASLPVPILISLQDPPVDMGGALGPALLLTSLLGAWAGLGPGQGEQAVTVAVVF
GSSGLPQAQARIRLTPQSFLDLPLEIQPLTVGVNNTNPSSLLTQICGLLGAAHVHGIVFE
DNVGTEAVAQILDFISSQTHVPILSISGGSAVVLTPKEPGSAFLQLGVSLEQQLQVLFKV
LEEYDWSAFAVITSLHPGHALFLEGVRAVADASYLSWRLLDVLTLELGPGGTRARTQRLL
RQIDAPVLVAYCSREEAEVLFAEAAQAGLVGPGHVWLVPSLALGSTDAPPAVFPVGLISV
VTESWRLSLRQKVRDGVAILALGAHGYLRQHGALPAPAGDCRSHPGPVSSARQAFYRHLL
NVTWEGRDFSFSPGGYLVQPTMVVIALNRHRLWEMVGRWDHGILHMKYPVWPRYSATLQP
VVDSRHLTVATLEERPFVIVESPDPGTGGCVPNTVPCRRQSNHTFSSSDTAPYTKLCCKG
FCIDILKKLAKVVKFSYDLYLVTNGKHGKRVHGVWNGMIGEVYYKRADMAIGSLTINEER
SEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPSVWVMMFVMCLTVVAVTVFMFEY
FSPVSYNQNLTSGKKSGGPSFTIGKSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFA
VIFLASYTANLAAFMIQEQYIDTVSGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNY
RDMHSHMVKFNQRSVEDALTSLKMGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFAT
TGYGIAMQKDSHWKRAIDLALLQFLGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMA
GVFYMLLVAMGLALLVFAWEHLVYWRLRHSVPNTSRLDFLLAFSRGIYSCFGGVQSLASP
ARPPSPDLTASSAQASVLKMLQAARDMVTTAGVSSSLDRATRTIENWGSRRAPPPPASPG
PPRPNPGPPPNPSPNGWRPPGGCRAAPGRRAPQPPGRPPTPGPPLPDVSQVSGAPAWEAR
WPSRTRRSGWHLSASERRALPERPLSPERCYYSSFPRADRSGRPFLPLFPEPPEPENLPL
LGPEQLARREALLHAAWARGARARHASLPCSVAEAFARPSSLPAQCARPACGRLAQSMRL
PSYREACQEGVWAGAPAWPHRQHACLHAHAHLPLCWRAVCPHLPPCARHGPWLAAAWGPP
GHRGRTLGKSTSYRDRGGLEEVNKVACGTHGFLGPCTWRRINSLESEV
NT seq 3747 nt   +upstreamnt  +downstreamnt
atgttttctctctgtgcctctgcctccctccctgtgcccatcctgatctctctgcaggac
cctccagtggacatgggtggggccctggggccggccctgctgctcacctcactcctcggt
gcctgggcagggctgggcccagggcagggcgagcaggctgtgacggtggccgtggtgttt
ggcagctcggggctgccacaggcccaagcccggattcgcctcaccccccagagcttcctg
gacctgcccctggagatccagccactcaccgtgggggtcaacaacaccaaccccagcagc
ctcctcacccagatctgtgggctcctgggcgccgcccacgtccacggcatcgtcttcgag
gacaacgtgggcactgaggctgtggcccagatcctcgacttcatctcctcccagactcac
gtgcctatcctcagcatcagtgggggctccgctgtggtcctcacccccaaggagcccggc
tccgccttcctgcagttgggcgtgtccctggagcagcagctgcaggtgctgttcaaggtg
ctggaggagtacgactggagcgcgttcgccgtgatcaccagcctgcacccgggccacgcg
ctcttcctcgagggcgtgcgcgctgtcgccgacgccagctacctgagctggcgactgctg
gacgtgctcacgctggagctgggccccggtgggacgcgcgcccgcacccagcgcctgctg
cgccagatcgacgcccctgtgctggtggcctactgctcgcgcgaggaggcagaggtgctc
ttcgctgaggcggcgcaggccggcctggtggggcccgggcacgtgtggctggtgcccagc
ctggcactgggcagcaccgacgcgccccccgccgtcttcccagtgggcctcatcagcgtc
gtcaccgagagctggcgactaagcctgcgccagaaggtccgtgacggcgtggccattctg
gccctgggcgcccacggctacctgcgacagcatggagccctgcccgccccggccggggac
tgtcgcagccaccctgggcctgtcagctctgcccggcaggccttctacaggcacctgctg
aacgtcacctgggagggccgggacttctccttcagccccggtgggtacctagtccagccc
accatggttgtgatcgccctcaaccggcaccgcctctgggagatggtggggcgctgggac
cacggcatcctccacatgaagtaccccgtgtggcctcgctacagcgccaccctgcagccc
gtggtcgacagccggcacctgacggtggccacgctggaagagcggccctttgtcattgtg
gagagccccgaccctggcacgggcggctgtgtgcccaacactgtgccctgccgcaggcag
agtaaccacaccttcagcagcagtgacacagccccctataccaagctttgctgtaagggc
ttctgcattgacatcctcaagaaactagccaaggtggtcaagttctcctacgacctgtac
ctggtgaccaacggcaaacacgggaagagggtgcacggcgtgtggaacggcatgatcggg
gaggtgtactacaagcgggcggacatggccatcggctccctcaccatcaacgaggagcgc
tccgagatcgtggacttctccgtgcccttcgtggagacgggcatcagcgtgatggtggcc
cgcagcaacggcaccgtgtccccctccgccttcctggagccctacagcccttcggtgtgg
gtgatgatgttcgtcatgtgcctcaccgtggtggccgtcaccgtcttcatgttcgagtac
ttcagccccgtcagctacaaccagaacctcaccagcggcaagaagtctggaggcccgtcc
ttcaccattggcaagtccgtgtggctgctgtgggcgctggtcttcaacaactcagtgccc
atcgagaacccccggggcaccaccagcaagatcatggtcctggtctgggccttttttgcc
gtcatcttcctcgccagctacactgccaacctggccgccttcatgattcaggagcagtac
atagatactgtgtctggcctcagtgacaagaagtttcagcggcctcaagaccagtacccg
cccttccgctttggcacggtgcccaacggcagcaccgagaggaacatccgcagcaactac
cgcgacatgcacagccacatggtcaagttcaaccagcgctcggtggaggatgccctcacc
agcctcaagatggggaagctggacgccttcatctacgacgctgctgtcctcaattacatg
gcgggcaaggacgagggctgcaagctggtcaccatcggctcgggcaaggtcttcgccacc
actggctacggcatcgccatgcagaaggactcccactggaagcgggccatcgacctggca
ctcctgcagttcctgggggatggggagacacagaagctggagacggtgtggctctcgggg
atctgccagaacgagaagaacgaggtgatgagcagcaagctggacatcgacaacatggcc
ggcgtcttctacatgctgctcgtggccatggggctggcactgctggtcttcgcctgggag
cacctggtgtactggaggctgcgccactctgtgcccaacacgtcccggctggacttcctg
ttggccttcagcaggggcatctacagctgcttcggcggggtgcagagcctggccagcccc
gcgcggccacccagcccggacctcaccgccagctcggcccaggccagcgtgctcaagatg
ctgcaggccgcgcgtgacatggtgaccacagcaggggtgagcagctccctggaccgcgcc
acgcgcaccattgagaactggggcagccgccgcgcccctccgcctcccgccagccctggc
cctccgcggcccaaccccggcccgccccccaacccgagccccaacggctggaggccacca
ggaggatgccgcgccgcgccagggcgcagggcaccgcagcccccgggccgccccccgacg
ccagggccgcccctgcccgacgtttcccaggtgtcgggcgcgccggcctgggaggcacgg
tggccgtcgcggacccggcgcagcgggtggcacctctcggcctccgaacggcgcgcgctc
ccggagcgccccctgtcgcccgagcgctgctactacagttctttccctcgagccgaccgg
tcggggcgccccttcctcccgctcttcccggagcccccggagcccgagaacctgcccctg
ctcgggccggagcagctggcccggagggaggccctgctgcacgccgcctgggcccggggc
gcccgcgcacgccacgcctccctgccctgctcggtggcggaggccttcgccaggcccagc
tcgctgcccgcccagtgtgcccgcccagcctgcgggcgcttggcacagtcgatgcggctg
ccgtcctaccgggaggcctgccaggagggcgtgtgggcgggggcccccgcctggccgcac
agacagcacgcctgcctccacgcccacgcccacctgccgctttgctggagggctgtctgc
cctcatctcccaccctgcgcccgccatggcccctggctcgctgcggcctgggggcctcca
gggcacaggggcaggaccctggggaagagcacaagctacagggaccgtggggggctggaa
gaagtcaacaaggtggcctgtgggacgcacggcttcctggggccttgcacttggaggcgg
atcaacagcttggagtcagaagtgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508606
Entry
107508606         CDS       T06036                                 

Gene name
GRIN2B
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2B
  KO
K05210  glutamate receptor ionotropic, NMDA 2B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04724  Glutamatergic synapse
ray04728  Dopaminergic synapse
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05033  Nicotine addiction
ray05034  Alcoholism
ray05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107508606 (GRIN2B)
   04015 Rap1 signaling pathway
    107508606 (GRIN2B)
   04024 cAMP signaling pathway
    107508606 (GRIN2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107508606 (GRIN2B)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107508606 (GRIN2B)
   04728 Dopaminergic synapse
    107508606 (GRIN2B)
   04720 Long-term potentiation
    107508606 (GRIN2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107508606 (GRIN2B)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107508606 (GRIN2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107508606 (GRIN2B)
   05014 Amyotrophic lateral sclerosis
    107508606 (GRIN2B)
   05016 Huntington disease
    107508606 (GRIN2B)
   05017 Spinocerebellar ataxia
    107508606 (GRIN2B)
   05020 Prion disease
    107508606 (GRIN2B)
   05022 Pathways of neurodegeneration - multiple diseases
    107508606 (GRIN2B)
  09165 Substance dependence
   05030 Cocaine addiction
    107508606 (GRIN2B)
   05031 Amphetamine addiction
    107508606 (GRIN2B)
   05033 Nicotine addiction
    107508606 (GRIN2B)
   05034 Alcoholism
    107508606 (GRIN2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107508606 (GRIN2B)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107508606 (GRIN2B)
SSDB
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 107508606
NCBI-ProteinID: XP_015996018
LinkDB
Position
Unknown
AA seq 1488 aa
MKPRAECCSPKFWLVLAVLAVSGSRARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQ
DFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYI
FEVANSVGLTGYGYTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIVTENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSF
TIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYV
DQVSGLSDKKVREPGDFFPPLLTPCAFGTVPNGSTERNIRNNYAEMHSYMGKFNQRGVDD
ALLSLKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQV
DLAILQLFGDGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITF
ICEHLFYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHS
NILRLLRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEE
NLFSDYISEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSASSIDGLYDCDNPPFTTQPR
SISKKPLDIGLPSSKHSQLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGN
AAKRRKQQYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQ
FRPKENSPHWEHVDLTDIYKERSDDFKRDSVSGGGPCTNRSHLKHGAGDKHGVVGGVPAP
WEKNLTNVEWEDRSGGNFCRSCPSKLHNYSAAVAGQNSGRQACIRCEACKKAGNLYDISE
DNSLQELDQPAAPVAVTSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAA
LAPRSVSLKDKGRFVDGSPYAHMFEMPAGESTFANNKSSVPTAGHHHHNNPGSGYMLSKS
LYPDRVTQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGAPKARPDFRALVTNKPVVSALHG
AVPGRFQKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
NT seq 4467 nt   +upstreamnt  +downstreamnt
atgaagcccagagcagagtgctgttctcccaagttctggttggtgttggctgtgctggcc
gtgtcgggaagcagagctcgttctcagaagagcccccccagcattggcattgctgtcatc
ctcgtgggcacttcagacgaggtggccatcaaggatgcccacgagaaagatgatttccac
catctctctgtggtgccccgtgtagagctggtagccatgaatgagacggacccaaagagc
atcatcacccgcatctgtgatctcatgtctgaccggaagatccaaggggtggtgtttgct
gatgacacagaccaggaagccatcgcccagatccttgacttcatttcagcccagactctc
acccctatcctgggcatccacgggggatcctcgatgataatggcagataaggatgaatcc
tccatgttcttccagtttggcccatcgattgaacagcaagcttccgtaatgctcaacatc
atggaagagtatgactggtacatcttttctattgtcaccacctacttccctggctaccaa
gactttgtaaacaagattcgcagcaccattgagaatagctttgtgggctgggagttagag
gaagtcctcctgctggacatgtccctggatgacggagattctaagatccagaaccagctc
aagaaacttcaaagccccatcattcttctttattgtactaaagaagaggccacctacatc
ttcgaagtggcaaactcagtagggctgactggctatggctacacgtggattgtgcctagt
ctggtggcaggggatacagacacagtgccctcggagttccccactgggctcatctctgtg
tcctatgatgaatgggactatggcctccctgccagagtgagagatggaattgccataatc
accaccgctgcttctgacatgctgtctgaacacagcttcatccctgagcccaagagcagt
tgttacaacacccatgagaagagaatctaccagtccaatatgctgaataggtatttgatc
aatgtcacttttgaggggagaaatctgtccttcagcgaagatggctaccagatgcacccg
aagctggtgataatccttctgaacaaggagaggaagtgggagagggttgggaagtggaaa
gacaagtccctgcagatgaagtactacgtgtggccccgaatgtgtcctgagacggaagaa
caagaggatgaccatctgagcatcgtgactctggaagaggccccgtttgtcattgtggaa
agtgtggaccctctgagtggaacctgcatgaggaatacagtcccctgtcaaaaacgcata
gtcaccgagaataaaacagacgaggagccaggttatatcaaaaaatgctgcaaggggttc
tgtattgacatccttaagaaaatttctaagtctgtgaagttcacctatgatctttacctg
gttaccaatggcaaacatggaaagaaaatcaatggaacctggaatggtatgattggagag
gtggtcatgaagagggcctacatggcggtggggtcactcaccatcaacgaagagcgatcc
gaggtggtcgacttctctgtgcccttcatagagactggcatcagtgtcatggtgtcacgc
agcaatgggaccgtctcaccttctgccttcttagagcccttcagtgctgacgtctgggtt
atgatgtttgtgatgctgctcatcgtctcagccgtggccgtctttgtctttgagtacttc
agccctgtgggttacaacaggtgcctcgccgatggcagagagccaggcggcccatccttc
accatcggcaaagctatttggttgctctggggtctggtgtttaacaactccgtacccgtg
cagaacccaaaggggaccacctccaagatcatggtgtcggtgtgggccttctttgctgtc
atctttctggccagctacactgccaacttagctgccttcatgatccaagaggaatatgtg
gaccaggtttccggcctgagtgacaaaaaggtaagagaaccaggagacttttttccaccc
cttctcaccccctgtgcctttgggactgtgcccaatggcagcacagagaggaatattcgc
aataactacgcagaaatgcattcctacatgggaaagttcaaccagaggggtgtagatgat
gcattgctgtctctgaaaacagggaaactggatgctttcatctatgatgcggcagtgctg
aactacatggcaggcagagatgaaggctgcaagctggtgaccattggcagtggaaaggtc
tttgcttccactggttacggcattgccatccaaaaagattctgggtggaagcgccaggtg
gacctcgctatcctgcagctcttcggagatggggagatggaagagctggaagccctctgg
ctcactggcatttgccacaatgagaagaatgaggtcatgagcagccagctggacattgac
aacatggcgggcgtcttctacatgttgggtgcagccatggctctcagcctcatcaccttc
atttgcgagcaccttttctactggcagttccggcattgctttatgggtgtctgttctggc
aagcctggcatggtcttctccatcagcagaggtatctacagctgcatccatggagtggct
atcgaggagcgccaatctgtgatgaactcccccaccgcgaccatgaacaacacgcactcc
aacatcctgcgcctgctccgcacggccaagaacatggctaacctgtccggtgtgaacggc
tccccgcagagcgccctggacttcattcgtcgcgagtcatccgtctacgacatctctgag
caccgccgcagcttcacgcactccgactgcaaatcctacaacaaccctccctgcgaggag
aacctcttcagcgactacatcagcgaggtggagagaacttttgggaacctgcagctgaag
gacagcaacgtgtaccaagatcactatcaccaccaccaccggccccacagcatcggcagc
gccagctccatcgacgggctctacgactgtgacaacccgcccttcaccacccagccgagg
tccatcagcaagaagcccttggacattggcctcccctcctccaaacacagccagctgagc
gacctgtacggcaagttctccttcaagagtgaccgctacagtggccacgatgacttgatc
cgctcggacgtgtccgacatctccacccacacggtcacctacggaaacatcgagggcaac
gccgccaagaggcgtaagcagcaatacaaggacagcctgaagaagcggccggcctcggcc
aagtcccggcgcgagttcgacgagatcgagctggcctaccgccgccggccgccgcgctcc
cctgaccacaagcgctacttcagggacaaggaagggctgcgggacttctacctggaccag
ttccgccccaaggagaactcgccgcactgggagcacgtggacctgaccgacatctacaag
gagcggagcgacgacttcaagcgcgactcggtcagcgggggagggccctgtaccaacagg
tctcacctcaaacacggggcgggcgacaaacacggcgtggtcggcggggtcccggcgccc
tgggagaagaacctgaccaacgtggagtgggaggaccgctccgggggcaacttctgccgc
agctgcccctcgaagctgcacaactactccgcggcggtggcagggcagaactcggggcgg
caggcgtgcatccgctgcgaggcgtgcaagaaagcggggaacctgtatgacatcagcgag
gacaactccctgcaggagctggaccagccggctgccccggtggcggtgacgtccaacgcc
tccaccaccaagtacccgcagagcccgaccaactccaaggcccagaagaagaaccggaac
aaactgcgccggcagcattcctacgacaccttcgtggacctgcagaaggaagaagccgcc
ttggccccgcgcagcgtgagcctgaaagacaagggccgtttcgtggatgggagtccctac
gcccacatgtttgagatgccagctggtgagagcacctttgccaacaacaagtcctcagtg
cccactgccggacaccaccaccacaacaaccccggcagcggctacatgctcagcaagtcg
ctctaccctgaccgggtcacgcaaaaccctttcatccccacttttggggacgaccagtgc
ttgctccatggcagcaaatcctacttcttcaggcagcccacggtggcgggggcgccgaaa
gccaggccggacttccgcgcccttgtcaccaacaagccggtggtctcggccctccatggg
gctgtgccaggccgtttccagaaagacatctgtatagggaaccagtccaacccctgtgtg
cctaacaacaaaaaccccagggctttcaatggctccagcaatggtcatgtttatgagaaa
ctttctagtattgagtctgatgtctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514651
Entry
107514651         CDS       T06036                                 

Gene name
GRIN2A
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor ionotropic, NMDA 2A
  KO
K05209  glutamate receptor ionotropic, NMDA 2A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04724  Glutamatergic synapse
ray04728  Dopaminergic synapse
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05033  Nicotine addiction
ray05034  Alcoholism
ray05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107514651 (GRIN2A)
   04015 Rap1 signaling pathway
    107514651 (GRIN2A)
   04020 Calcium signaling pathway
    107514651 (GRIN2A)
   04024 cAMP signaling pathway
    107514651 (GRIN2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107514651 (GRIN2A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    107514651 (GRIN2A)
   04728 Dopaminergic synapse
    107514651 (GRIN2A)
   04720 Long-term potentiation
    107514651 (GRIN2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107514651 (GRIN2A)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107514651 (GRIN2A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107514651 (GRIN2A)
   05014 Amyotrophic lateral sclerosis
    107514651 (GRIN2A)
   05017 Spinocerebellar ataxia
    107514651 (GRIN2A)
   05020 Prion disease
    107514651 (GRIN2A)
   05022 Pathways of neurodegeneration - multiple diseases
    107514651 (GRIN2A)
  09165 Substance dependence
   05030 Cocaine addiction
    107514651 (GRIN2A)
   05031 Amphetamine addiction
    107514651 (GRIN2A)
   05033 Nicotine addiction
    107514651 (GRIN2A)
   05034 Alcoholism
    107514651 (GRIN2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107514651 (GRIN2A)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   107514651 (GRIN2A)
SSDB
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 107514651
NCBI-ProteinID: XP_016008037
LinkDB
Position
Unknown
AA seq 1215 aa
MRLSPVPGMEGASLSLRRQRALYKLLLASSFVFLFCFVFTCRQDPTSTFFQFGASIQQQA
TVMLKIMQDYDWHVFSLVTTIFPGYRDFISFIKTTVDNSFVGWDMQNVITLDTSFEDAKT
QVQLKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSG
LISVSYDDWDYSLEARVRDGLGILTTAASSMLERFSYIPEAKASCYGQAEKPDIPLHTLH
QFMVNVTWDGKDLSFTEEGYQVHPRLVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKS
FSDCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKC
CKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTIN
EERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFV
FEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWA
FFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIR
NNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYI
FATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDID
NMAGVFYMLAAAMALSLITFIWEHLFYWKLRFCFTGVCSDRPGLLFSISRVSTRGGGFLW
QRQVQEGTGLPGSRGVPTPGPRVRTSSPYPPTLPGRVGKASGLWVFVRQGLPTQVTMEAR
KKRRIGEAGRAGKTAYLGTTCSNELLNNVRGQHPQRPTPTRCTREHRGQASSRPRQLWKK
SMDSLRQVHSVTQNPVSQRDEGTVENRTHSLKSPRYLPEEVAHSDISETSTRVGSAWHRE
PGLRRDNFKRSVASKYPKDCGEVERSYLKTKASSPRDKIYTIDGEKEPSFHLDAPQFLEN
MALSENVDFPDPYQDRGESFRQGDPTLPMNRNPPRKEDGLPNNDQYKLYSKHFTLKDKSS
PLSEGSDRYRQNSTHCRSCLSNLPTYAGHFTVRSPFKCDACLRMGNLYDIDEDQMLQETG
NPATQEEVYQQDWAQNNALQFQKNKLRISRQHSYDNILDKPRELDLSRPSRSICSGGRIP
AAMETRVPSAPSLNV
NT seq 3648 nt   +upstreamnt  +downstreamnt
atgcgtttatctccagttcctggaatggaaggagcttctttaagcctacgaagacagagg
gcactttataaattgcttttggcctcatcctttgtttttttgttttgttttgtttttacc
tgtcgacaggacccgacgtctaccttcttccagtttggcgcatccatccaacaacaagcc
acggtcatgctgaagatcatgcaggattacgactggcacgtcttctccctggtgaccacc
atcttccccggctacagggacttcatcagcttcatcaagaccacagtggacaatagcttt
gtgggttgggacatgcagaacgtgatcaccctggacacttccttcgaggatgccaagact
caagttcagttgaagaagatccactcttctgtcatcttgctctactgttccaaagatgag
gccgtcctcatcctgagtgaggcccgctcccttggcctcaccgggtacgatttcttctgg
attgtcccaagcctggtctctgggaacacggagcttatccccaaagagtttccatcagga
ctcatttcagtctcttacgatgactgggactacagcctcgaggcgcgagtaagggacggc
ctgggcatcctaaccactgctgcgtcttccatgttggagaggttctcctacatccctgaa
gccaaggccagctgctacgggcaggcggagaagccagacatcccgctgcacactctgcac
caattcatggtcaatgtgacatgggatggcaaagacctgtccttcactgaggaaggctat
caggtgcaccccaggctggtggtgatcgtgctgaacaaggaccgagaatgggaaaaggtg
ggcaagtgggaaaaccagaccctgagcctgaggcacgctgtgtggccaaggtacaagtcc
ttttcggactgtgagccagacgacaaccacctgagcatcgtcaccctggaggaggcgccc
tttgtcatcgtggaggacatagacccgctgaccgagacgtgtgtaaggaacactgtacca
tgtcggaagttcgtcaaaatcaataattcaaccaacgagggaatgaatgtaaagaaatgc
tgcaagggcttctgcatcgatatcctaaagaagctttctagaaccgtcaagtttacctat
gacctttacctggtgacgaacgggaagcatggcaaaaaagttaacaacgtgtggaacgga
atgataggcgaagtggtctatcagcgggcggtcatggctgtgggctcactcaccatcaat
gaggaacgttccgaagtggtggacttctccgtgcccttcgtggagacgggaatcagcgtc
atggtttcgagaagcaacggcaccgtgtcaccctctgcttttctagaaccattcagtgcc
tccgtctgggtgatgatgttcgtgatgctgctcattgtctccgccatagccgtgttcgtc
ttcgaatacttcagtcctgtgggatacaacagaaacttagccaaagggaaagcacctcac
gggccctcttttaccattggaaaagctatatggctcctttggggcctggtgttcaacaac
tccgtgcctgtccagaaccctaaaggcaccaccagcaagatcatggtgtccgtgtgggcc
ttctttgctgtcatattcctggccagctacacggccaatctggcggctttcatgatccag
gaggagtttgtggaccaagtgaccggcctcagcgacaaaaagtttcagagaccccacgac
tattccccaccttttcgattcggcacggtgcctaatggcagcaccgaaaggaacattcgg
aataactacccctacatgcatcagtacatgaccaaatttaatcagaagggagtagaggac
gccttggtcagcttgaaaacagggaagctggacgcgttcatctacgatgcggcggtcttg
aattacaaggccgggcgggacgaaggctgcaagcttgtgaccatcgggagtggatacatc
tttgccaccactggttacgggatcgccctccagaaaggctccccttggaagaggcagatt
gacttggccctgcttcagtttgtgggcgacggtgagatggaggagctggagaccctgtgg
cttacgggcatctgccacaacgagaagaacgaggtgatgagcagtcagctggacatcgac
aacatggcgggcgtgttctacatgctggcggccgccatggccctgagcctcatcactttc
atctgggagcacctcttctactggaagctgcgcttctgtttcacgggcgtgtgctcagat
cggccggggctgctcttctccatcagcagggtcagtacccgcggcggcggcttcctttgg
cagcggcaggtccaggaaggcacagggcttccagggagccggggagtcccgactcctggt
ccgagggtccgcacatcctctccttacccaccaacccttcctgggcgtgtcggaaaggca
tccgggttgtgggtgttcgtaaggcaagggctgccaacccaggtgactatggaagccaga
aaaaaaaggcgaatcggggaagcgggccgggcgggaaagacagcatatttggggacaaca
tgttcgaatgagctcctcaacaacgttcgtggccaacaccctcaacgaccaaccccaaca
cggtgcacccgtgagcacagaggccaagcaagctcccggcctcggcagctttggaagaag
tccatggactcgctacgccaagtccattcggtgacacagaaccccgtttcccagagggac
gaaggcaccgtggagaacaggacccactccctgaagagccccaggtaccttccagaagag
gtggcccactcggacatttcggaaacttccacaagagtcgggtccgcgtggcacagggag
cccggactgcggcgagacaacttcaaaaggtcggtggcctccaagtaccccaaggactgc
ggcgaggtcgagcgctcctacctgaagaccaaagccagctcccccagggacaagatctac
accatagacggtgagaaggagcccagtttccacctggacgccccccagttcttggaaaac
atggccctttcggagaacgtggacttcccagacccctaccaggaccgcggcgagagcttc
cgccagggggaccccacgctgcccatgaacaggaaccccccgcgcaaggaggatgggctt
cccaacaatgaccagtataaactctactccaagcacttcaccttgaaggacaagagctcc
ccgctgagcgagggcagcgaccggtaccggcagaactccacgcactgcaggagctgcctg
tccaacctgcccacctacgcaggccacttcaccgtgcggtcccccttcaagtgcgacgcc
tgcctgcggatggggaacctctacgacatcgatgaagaccagatgcttcaggagacaggt
aatccagccacccaggaggaggtctaccagcaggactgggcgcagaacaacgccctccag
ttccaaaagaacaagctccgaatcagccgtcagcattcctatgataacattctcgacaaa
cctagggagctggaccttagcaggccctctcggagcatatgctctggagggagaattcct
gcagcaatggaaacgcgtgtaccaagtgccccatccctcaatgtttaa

DBGET integrated database retrieval system