KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498866
Entry
107498866         CDS       T06036                                 

Gene name
KCNJ14
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 14
  KO
K05007  potassium inwardly-rectifying channel subfamily J member 14
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04725  Cholinergic synapse
ray04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107498866 (KCNJ14)
  09156 Nervous system
   04725 Cholinergic synapse
    107498866 (KCNJ14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107498866 (KCNJ14)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107498866 (KCNJ14)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 107498866
NCBI-ProteinID: XP_015977969
LinkDB
Position
Unknown
AA seq 434 aa
MGLARALRRLSGALESGDSRAGDEEEAGPGLCRNGWAPSLLPVGRRRGRFVKKDGHCNVR
FVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAAPP
PPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVG
AVMAKMAKPKKRNETLVFSENAVVALRDRRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVT
PEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSSSPLYELGRAELARADFELVVI
LEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPVCS
AKELDERAERASQSPKSSFPGSLAAFCYENELALSCCQEDEEEEEAKEGDEVEAEDAAAS
PRVLTPTLALTLPP
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgggcctggccagggccctgcgccgccttagcggcgccctggaatcaggcgacagccgg
gcaggcgatgaggaggaggccgggccggggctgtgccgcaacgggtgggcaccttcgctg
ttgccagtggggcgtcgccgcgggcgcttcgtcaagaaggatggccactgcaacgtccgc
ttcgtgaacctgggcggccagggcgcgcgctacctgagcgacctgttcaccacatgcgtg
gatgtgcgctggcgctggatgtgcctgctcttctcctgctccttcctcgcctcctggctg
ctcttcggcctggccttctggctcatcgcctcgctgcacggcgacctggccgccccgccg
ccgccggcgccctgtttctcgcatgtggccagcttcctggccgccttcctcttcgcgctg
gagacgcagacgtccatcggttacggcgtgcgcagcgtcaccgaggagtgcccggccgcc
gtggccgccgtggtgctgcagtgcatcgctggctgcgtgctcgacgccttcgtcgtgggc
gccgtcatggccaagatggccaagcccaagaagcgcaacgagacgctcgtcttcagcgag
aacgcggtggtggcgcttcgcgaccgccgcctctgcctcatgtggcgcgttggcaatctg
cgccggagccacctcgtcgaggcccacgtgcgggcccagctgctgcagcctcgagtgacc
ccggagggtgagtacatacccctggaccaccaggacgtggacgtgggcttcgatggcggc
actgatcgcatcttccttgtgtctcccatcaccatcgtgcacgagattgactcctctagt
cctctgtatgaactaggacgtgccgagctggcccgggccgactttgagctggtggtcatt
ctcgagggcatggttgaggccacagctatgaccacacagtgtcgctcttcctatctccct
ggtgagctgctctggggccatcgttttgagccagtcctcttccagcgtggctcccagtat
gaggtcgactatcgtcacttccatcgcacttatgaggtcccagggacaccggtctgtagt
gccaaggaactggacgaacgggcagaacgggcttcccagagccccaagtctagcttcccc
ggctctctggctgcattttgttatgagaacgaacttgctttgagctgctgtcaggaggat
gaggaggaagaggaggccaaggagggggacgaagtggaggcagaggatgcagctgccagc
cctcgcgtgctcacaccaaccctggctctgaccttgcccccgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503177
Entry
107503177         CDS       T06036                                 

Gene name
KCNQ1
Definition
(RefSeq) LOW QUALITY PROTEIN: potassium voltage-gated channel subfamily KQT member 1
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04725  Cholinergic synapse
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107503177 (KCNQ1)
  09154 Digestive system
   04971 Gastric acid secretion
    107503177 (KCNQ1)
   04972 Pancreatic secretion
    107503177 (KCNQ1)
   04974 Protein digestion and absorption
    107503177 (KCNQ1)
  09156 Nervous system
   04725 Cholinergic synapse
    107503177 (KCNQ1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107503177 (KCNQ1)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107503177 (KCNQ1)
SSDB
Motif
Pfam: KCNQ_channel Ion_trans Ion_trans_2 WDCP ATPase_2 PsbW
Other DBs
NCBI-GeneID: 107503177
NCBI-ProteinID: XP_015986615
LinkDB
Position
Unknown
AA seq 651 aa
MAAASSPPRAERKRWGWGRLPGARRGSAGLAKKCPFSLELAEDHPAPGAPPAADLDPRPR
MSLDPRVSIYSARRPLLARTHVQGRVYNFLERPTGWKCFVYHFAVFLIVLACLIFSVLST
IEQYVALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGIWGRLRFARKPISIIDLI
VVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELIT
TLYIGFLGLIFSSYFVYLAEKDAVDESGRVEFGSYADALWWGVVTVTTIGYGDKVPQTWV
GKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAA
ENPDSATWKIYVRKPSRGHSLPSPSPKPKKSAMVKKKKFKLDKDNGVSPGEKMLTVPQIT
CDHVSDERRSDHFSVDYYDSSGKKSPMLLEVSTPQFVRTNSFTEDLDLEGETLLAPITHV
SQLREHHRATIRVVRRMQYFVAKKRFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQRRL
DQSIGKPSLFIAVSEKSKDRGSNTIGARLHRVEDKVTQLDQRLVLITDMLQQLLSLNQDG
PPGGQPPSGSGAHVARPCXESSINPELFLPSSALPTYEQLTVPRRGPDEGS
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggccgcggcctcctccccgccccgggcggagaggaagcgctggggctggggccgtctg
cccggcgcccggaggggcagcgcgggcctggccaagaagtgccccttctcgctggagctg
gccgaggaccacccggcgcccggcgcgccgcccgccgccgacctcgacccgcggccgcgc
atgagcctcgacccgcgcgtgtccatctacagcgcgcgccgcccgctgctcgcgcgcacc
cacgtccagggccgcgtctacaacttcctggagcgccccaccggctggaagtgcttcgtc
taccacttcgccgtcttcctcatcgtcctggcctgcctcatcttcagcgtgctgtccacc
atcgagcagtatgtagcactggccacgggcaccctcttctggatggagatcgtcctggtg
gtgttcttcgggacggagtacgtggtgcggctctggtcggccggctgccgcagcaagtac
gtgggcatctggggccggctgcgcttcgcccggaagcccatctccatcatcgacctcatc
gtggtcgtggcctccatggtggttctctgcgtgggctccaaggggcaggtgtttgccacc
tcggccatcaggggcatccgcttcctgcagatcctgcgcatgctgcacgtggaccgccag
ggcggtacctggaggctgctgggctccgtggtcttcatccatcgccaggagctgatcacc
acactgtacatcggcttcctgggcctcatcttctcctcctacttcgtgtacctggccgag
aaggacgccgtggacgagtcgggccgcgtggagttcggcagctacgcagacgccctgtgg
tggggtgtggtcacggtcaccaccatcggctacggggacaaggtgccgcagacctgggtc
gggaagaccatcgcctcctgcttctccgtcttcgccatctccttcttcgcgctcccagcg
ggcatcctcggctccggcttcgccctgaaggtccagcagaagcagagacagaagcacttc
aaccggcagatcccggcggcggcctcgctcattcagacagcatggcggtgctacgccgca
gagaaccccgactcggccacctggaaaatctacgtgcggaagccgtcccggggccactct
ctgccgtcccccagccccaagcccaagaagtccgccatggtaaagaaaaaaaagttcaaa
ctggacaaggacaacggggtgagtccaggggagaagatgctcacggtcccccagatcacg
tgcgaccacgtctccgacgagcggaggtcggaccacttctccgtggactattatgacagt
tccgggaagaagagccccatgctgctggaggtgagcacgccccagttcgtgagaaccaac
agcttcaccgaggacctggacctggagggcgagacgctgctggcgcccatcacccacgtg
tcacagctgcgggagcaccatcgagccaccatcagggtcgtccggcgcatgcagtacttt
gtggccaagaagaggtttcagcaagcccggaagccctacgacgtgcgggacgtcatcgag
cagtactcccaaggccacctcaacctcatggtgcgcatcaaggagctacagagaaggctg
gaccagtccatcgggaagccctccctcttcatcgctgtctcagagaagagcaaggaccgc
ggcagcaacaccatcggcgcccgtctgcaccgggtggaggacaaggtgacacagctggac
cagaggctggtgctcatcacagacatgctccagcagctgctttcactgaaccaggacggc
cccccgggcggccagccccccagcgggagcggggcccacgtggcccggccctgcnncgag
agctccatcaaccccgagctcttcctgcccagcagcgccctgcccacctacgaacagctg
accgtcccccgcaggggtcccgacgaggggtcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504083
Entry
107504083         CDS       T06036                                 

Gene name
KCNQ3
Definition
(RefSeq) LOW QUALITY PROTEIN: potassium voltage-gated channel subfamily KQT member 3
  KO
K04928  potassium voltage-gated channel KQT-like subfamily member 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107504083 (KCNQ3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107504083 (KCNQ3)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107504083 (KCNQ3)
SSDB
Motif
Pfam: KCNQ_channel KCNQC3-Ank-G_bd Ion_trans Ion_trans_2 Lig_chan
Other DBs
NCBI-GeneID: 107504083
NCBI-ProteinID: XP_015988554
LinkDB
Position
Unknown
AA seq 892 aa
MALEFPGLQPPPPPRPRTPSALLLPRSSSXRRRRGGDGEGGGGLAGGAGGGGAANPAGGD
AAAAGDEERKVGLAPCEGEQVTLALGAGADKDGTLLLEGGGRDEGLRRTPQGLGLLAKTP
LSRPVKRNNAKCRRVQTLIYDALERPRGWALLYHALVFLIVLGCLILAVLTTFKEYETVS
GDWLLLLETFAIFVFGAEFALRIWAAGCCCRYKGWRGRLKFARKPLCMLDIFVLIASVPV
VAVGNQGNVLATSLRSLRFLQILRMLRMDRRGGTWKLLGSAICAHSKELITAWYIGFLTL
ILSSFLVYLVEKDVPEVDAQGGEMKEEFETYADALWWGLITLATIGYGDKTPKTWEGRLI
AATFSLIGVSFFALPAGILGSGLALKVQEQHRQKHFEKRRKPAAELIQAAWRYYATNPNR
IDLVATWRFYESIVSFPFFRKEQLEAAASQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDA
IEESPSKEPKPVGLNSKERFRTAFRMKAYAFWQSSEDAGTGEPMAEDRGYGNDFLIEDMI
PTLKAAIRAVRILQFRLYKKKFKETLRPYDVKDVIEQYSAGHLDMLSRIKYLQTRIDMIF
TPGPPSTPKHKKSQKGAAAFTYPSQQSPRNEPFVARASTSETEDQSMMGKFVKVERQVHD
MGKKLDFLVDMHIQHMERLQLHAAECCPAKAAASPAGLEKEDLKSIIRDYSETGPSGAPY
SFQQVPIDKVGPYGFFAHDPGTPPRGGSSSGKVQATLPASTAAFLERPTVLPILTLLDSR
GSYQSQAELPGSDWVSPRPRRSFTRDSDTPLSLMSVNHEELERSPSGFSISQDRDDVFGP
GGGPSWMREKRYLAEGETDTDTDPFTPSGSMPPSSTGDGISDSIWTPSNKPV
NT seq 2679 nt   +upstreamnt  +downstreamnt
atggcattggagttcccgggcttgcagccgccgccgccgcctcgtccacgcaccccgagc
gcccttcttcttccgcggagcagcagcnggagaaggcggcgcgggggcgacggcgagggc
ggcggggggctggccgggggcgccggaggcggcggggccgctaacccggccggaggggac
gcggcggcggccggcgacgaggagcgcaaagtggggctggcgccctgtgagggggagcaa
gtcaccttggcgctcggggccggagctgacaaagacgggaccctgctgctggagggcggc
ggccgcgacgaggggctgcgcaggaccccccagggcctcgggctgctggccaagaccccc
ctgagccgcccggtcaagaggaataacgccaagtgccggcgcgtccaaactttgatctac
gacgccctcgagagaccgcggggctgggcgctgctctaccacgcgctcgtgttcctgatt
gtcctggggtgcttgattctggccgtcctgaccacgttcaaggagtacgagaccgtttcg
ggggactggcttctattactggaaacgttcgctatcttcgtcttcggagccgagttcgcg
ctgcggatctgggcggccgggtgctgctgccggtacaagggctggcgcggacggctcaag
ttcgccaggaagcccctgtgcatgctggacatcttcgtgctgatcgcctccgtgcctgtg
gtcgccgtgggcaaccagggcaatgtcctggccacgtccctgcggagcctgcgtttcctg
cagatcctgcgcatgctccggatggaccgcaggggcggcacctggaagctcctgggctcc
gccatctgcgcgcacagcaaagagctcatcaccgcctggtatatcgggttcctgacgctc
atcctgtcttcgtttcttgtctacctggttgagaaggatgtgccggaggtggacgcacaa
ggaggagagatgaaagaggagtttgagacctacgcagatgccctttggtggggtctgatc
acgctggccaccatcggctacggagacaagacgcccaaaacgtgggagggccgcctgatc
gcagccaccttttccctgatcggcgtctccttctttgcccttccggccggcatcctgggg
tccgggctggcgctcaaggtgcaggagcagcaccggcagaagcactttgagaaaagaagg
aagccggccgctgagctcattcaggcggcctggaggtattacgccaccaaccccaacagg
atcgaccttgtggcgacatggagattctacgaatcaatcgtgtcttttccgttcttcagg
aaagaacagctggaggccgcagccagccaaaagctgggtctcttggatcgggttcgcctt
tctaatcctcgtggtagcaatactaaaggaaagctatttacccctctgaatgtagatgcc
atagaagaaagcccctctaaagaaccaaagcctgttggcttaaacagtaaagagcgcttc
cgcaccgccttccgcatgaaagcctacgctttctggcagagctctgaagatgccgggaca
ggggagcccatggcggaagacaggggctacgggaatgacttcctcatcgaagacatgatc
cccaccctgaaggctgccatccgagctgtcagaattctacaattccgtctctataaaaaa
aagttcaaggagactttgaggccttacgacgtgaaggacgtgattgagcagtattccgcg
ggacacctggacatgctctccaggataaagtacctgcagacgagaatagatatgattttc
acccctggaccgccatccaccccaaaacataagaagtctcagaaaggggcagcggcgttc
acctacccgtctcagcaatctcccaggaatgaaccattcgtagccagagcatccacgtcg
gaaaccgaagaccaaagcatgatggggaagttcgtgaaagtcgaaagacaggtgcacgac
atggggaagaagctggacttcctggtggacatgcacatccagcacatggaaaggctacag
ctgcacgccgcggagtgctgcccggccaaggcggccgcctcgcctgccgggctggagaag
gaggacctgaaaagcatcatccgcgactattccgagacgggcccctccggcgccccctac
agtttccagcaggtgcccatcgacaaagtcggcccctacgggttctttgcccacgacccg
gggacaccgccccgagggggatccagttctggaaaggttcaggcgacccttcccgcctcc
acagcagcgtttctggaaaggcccactgtcctgcctatcttgactcttctcgactcccga
gggagctaccagtcccaggcggaactgcccggctcggattgggtctccccgcggccgaga
cgcagcttcacgagggacagcgacacacccctgtccctgatgtccgtcaaccacgaggag
ctggagcggtctccgagcggcttcagcatctcccaagacagagacgatgtgttcggcccc
ggcgggggcccgagctggatgagggagaaacggtacctcgccgagggtgagacagatacg
gacacggaccccttcacgcccagcggctccatgcccccgtcgtccacgggcgacggcatc
tccgactcgatatggaccccttccaacaagcccgtctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505780
Entry
107505780         CDS       T06036                                 

Gene name
KCNQ2
Definition
(RefSeq) LOW QUALITY PROTEIN: potassium voltage-gated channel subfamily KQT member 2
  KO
K04927  potassium voltage-gated channel KQT-like subfamily member 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107505780 (KCNQ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107505780 (KCNQ2)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107505780 (KCNQ2)
SSDB
Motif
Pfam: KCNQ_channel KCNQC3-Ank-G_bd KCNQ2_u3 Ion_trans Ion_trans_2
Other DBs
NCBI-GeneID: 107505780
NCBI-ProteinID: XP_015991596
LinkDB
Position
Unknown
AA seq 872 aa
MVQKSRNGGVYPGPGGEKKLKVGFVGLDAGAPDSTRDGALLIAGSEAPKRGSILSKPRAG
GAGAGKPPKRNAVYRRLQNFLYNVLERPRGWAFIYHAYVFLLVFSCLVLSVFSTIKEYEK
SSEGALYILEIVTIVVFGVEYFVRVWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLVASI
AVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGF
LCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLI
GVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLRSTW
QYYERTVTVPVYSSQAQTYGASRLIPPLNQLELLRNLKSKSGLAFRKEPQPEPSPSKGKP
CREGLCGCCPGHSSQKVSLKDRVFSSPRGAAAKGKGSPQAQPVRRSPSADQSLEDSPSKV
PKSWSFGDRSRARQAFRAKGAASRQNSEEASLPGEDVVDDNKSCNCEFVTEDLTPGLKVS
IRAVCVMRFLVSKRKFKESLRPYDVMDVIEQYSAGHLDMLSRIKNLQSRVDQIVGRGPAM
TDKDRTKGPAEAELPEDPSMMGRLGKVEKQVLSMEKKLDFLVSIYMQRVGIPPAEAEAYF
GAKEPEPAPPYRSPEDGREPGERGGCIVKLIRSASSTGHKNFSAPPAAPATQCPPSTSWQ
QQSHGRPGHGASPXGDHGPLVRIPPPPAHERSLSAYGGGHRASTEFLRHEDAPACRPHEA
VPRDSDTSISIPSVDHEELERSFSGFSISQSRENLDALGCHAAAAPCAKVRPYIAEGESD
TDSDLCTPCGPPPRSATGEGPFGDVGWAGPRK
NT seq 2619 nt   +upstreamnt  +downstreamnt
atggtgcagaagtcgcgcaacggcggcgtgtaccccggcccgggcggggagaagaagctc
aaggtgggcttcgtggggctggacgccggcgcgcccgactccacccgggacggcgcgctg
ctcatcgccggctccgaggcccccaagcgcggcagcatcctcagcaagccgcgcgcgggc
ggcgcgggcgccgggaagccgccgaagcgcaacgccgtgtaccgcaggctgcagaacttc
ctgtacaacgtgctggagcggccgcgcggctgggccttcatctaccacgcctacgtgttc
ctgctggtcttctcctgcctggtgctgtcggtgttctccaccatcaaggagtacgagaag
agctcggagggcgcgctctacatcctggagatcgtgaccatcgtggtgttcggcgtggag
tacttcgtgcgcgtctgggcggcgggctgctgctgtcgctaccgcggctggaggggccgg
ctcaagttcgcccggaagcctttctgcgtgatcgacatcatggtgctcgtcgcctccatc
gccgtgctggccgccggctcccagggcaacgtgttcgccacgtccgcgctgcgcagcctg
cgcttcctgcagatcctgaggatgatccgcatggaccggcgtggcggcacctggaagctc
ctgggctccgtggtctatgcgcacagcaaggagctggtcaccgcctggtacatcggcttc
ctgtgcctcatcctggcctcgtttctggtgtacctggcggagaagggcgagaacgaccat
tttgacacctacgccgacgcgctctggtggggcctgatcacgctgacgaccatcggctac
ggggacaaatacccccagacctggaacgggaggctcctggcggcaaccttcaccctcatc
ggtgtctccttcttcgctcttcccgcgggcattctggggtctggctttgccctgaaggtc
caggagcagcaccggcagaagcacttcgagaagaggcggaaccccgctgcaggcctgatc
cagtccgcctggaggttctacgccaccaacctgtcccgcacagacctgcgctccacgtgg
cagtactacgagcggacggtcaccgtgcccgtgtacagctcgcaagctcaaacctacggg
gcctccagactcatcccgccgctcaaccagctggagctgctccggaacctgaagagcaag
tccggcctcgccttcaggaaggagccacagccggagccctctcccagtaaaggcaaaccg
tgcagagagggcctgtgtggatgctgccccggacactctagtcagaaggtcagtttgaaa
gaccgtgtcttctccagcccccgcggtgcggctgccaaggggaaggggtccccccaggcc
cagcctgtccgacggtcgcccagcgctgaccagagcctggaggacagccccagcaaggtg
cccaagagctggagcttcggggaccgcagccgagctcggcaggccttccgcgccaagggc
gctgcgtcccggcagaactcggaagaagcaagtctccctggggaggacgtcgtggacgac
aacaagagctgtaactgcgagtttgtgaccgaggacctgacccccggcctcaaagtcagc
atccgggctgtgtgtgtcatgaggttcctcgtgtccaagcggaagttcaaggagagcctg
cggccctacgacgtgatggacgtcatcgagcagtactcggccggccacctggacatgctg
tcccgcatcaaaaacctgcagtcaagagtggaccagatcgtggggcggggcccagccatg
acggacaaggaccgcaccaaaggccctgcggaggcggagctgcccgaggaccccagcatg
atgggccgcctggggaaggtggagaagcaggtgctgtccatggagaagaagctggacttc
ctggtgagcatctacatgcagcgagtgggcatcccgcctgcggaggccgaggcctacttc
ggggccaaggagccggagccggcgccgccgtaccgcagcccggaggacggccgcgagccg
ggcgagcggggcggctgcatcgtcaagctcatccgctccgccagctccacgggccacaag
aacttctcggcgccgccggccgcgcccgccacccagtgcccgccctccacctcctggcag
cagcagagccacgggcgcccgggccacggcgcctcgcccngtggggaccacgggccgctg
gtgcgcatcccgccgccgcccgcccacgagcggtcgctgtccgcctacggcgggggccac
cgggccagcacggagttcctgcggcacgaggacgccccggcctgccggccgcacgaggcc
gtgccgcgggacagcgacacgtccatctccatcccgtccgtggaccacgaggagctggag
cgctccttcagcggcttcagcatctcccagtcccgcgagaacctggacgccctcggctgc
cacgcggccgccgcgccctgcgccaaggtccggccctacatcgccgagggcgagtcggac
acggactcggacctgtgcaccccgtgcgggccgccgccgcgctccgccacgggcgagggc
cccttcggggacgtgggctgggccgggccccggaagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506758
Entry
107506758         CDS       T06036                                 

Gene name
KCNJ12
Definition
(RefSeq) ATP-sensitive inward rectifier potassium channel 12
  KO
K05005  potassium inwardly-rectifying channel subfamily J member 12/18
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04725  Cholinergic synapse
ray04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107506758 (KCNJ12)
  09156 Nervous system
   04725 Cholinergic synapse
    107506758 (KCNJ12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107506758 (KCNJ12)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107506758 (KCNJ12)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 DUF92
Other DBs
NCBI-GeneID: 107506758
NCBI-ProteinID: XP_015993095
LinkDB
Position
Unknown
AA seq 428 aa
MTTAGRANPYSIVSSEEDGLHLVTMSGTNGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGVIFWVIAVVHGDLEPAEDRGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISQQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSANSFCYENELAFLSRDEDDEADEDQDSSSPQARHDFDRLQAGGGALEQR
PYRRESEI
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgaccactgccggccgggccaatccctacagcattgtgtcatcagaggaggacggacta
cacctggttaccatgtcgggcaccaatggctttggcaatggcaaggtgcacacgcggcgc
aggtgccgaaaccgctttgtcaagaagaacggccagtgcaacattgagtttgccaacatg
gatgagaagtcacagcgctacctggctgacatgtttaccacctgcgtggatatccgctgg
cgctacatgctgctcatcttctcactggcctttcttgcctcctggctactatttggagtt
atcttttgggtcatcgctgtggtccatggcgacctggagccagctgaggaccgtggtcgc
acgccctgtgtgatgcaggtccatggcttcatggcagcattcctcttctccattgagacg
cagaccaccatcggctacgggctgcgctgtgtgacggaggagtgcccagtggctgtcttc
atggtggtggctcagtccattgtgggctgcatcatcgactcctttatgattggtgccatc
atggccaagatggccaggcccaagaagcgggcacagacgctactgttcagccacaatgct
gttgtggcgctgcgtgatggcaaactctgcctcatgtggcgtgtgggcaacctgcgtaag
agccacattgtggaggcccatgtgagggctcagcttatcaagccaagggtcacggaggag
ggtgagtatatcccactggaccagattgacattgatgttggctttgacaagggccttgac
cgcatcttcctggtgtcacccatcaccatcctgcatgagatcgatgaggccagcccactg
tttggcattagccagcaggacctggagacagatgacttcgaaattgtagttattctggag
ggcatggtggaggctactgccatgactacacaggcccgaagctcctacctggccaacgag
atcctgtggggtcaccgctttgagcctgtcctctttgaggagaaaaaccagtacaagatc
gattactcacatttccacaagacctacgaggtgccctccacgccccgctgcagtgccaag
gacctggtggagaacaagtttctactgcccagcgccaactccttctgctatgagaatgag
ctggccttcctaagccgtgatgaggatgatgaagcagatgaagaccaggatagcagtagc
ccacaggccaggcatgactttgacagactccaagctggtgggggtgcccttgagcagcgg
ccctacagacgagagtctgagatctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508311
Entry
107508311         CDS       T06036                                 

Gene name
KCNQ4
Definition
(RefSeq) LOW QUALITY PROTEIN: potassium voltage-gated channel subfamily KQT member 4
  KO
K04929  potassium voltage-gated channel KQT-like subfamily member 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107508311 (KCNQ4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107508311 (KCNQ4)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107508311 (KCNQ4)
SSDB
Motif
Pfam: KCNQ_channel Ion_trans Ion_trans_2 Cas9_C PKD_channel
Other DBs
NCBI-GeneID: 107508311
NCBI-ProteinID: XP_015995521
LinkDB
Position
Unknown
AA seq 695 aa
MAEAPPRRLGXGPPAGDAPRAELVALTAVQSEQGRGGRGGSPRRLGLLGSPLPPGAPLPG
PGSGSGSACGQRSSAAHKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLST
IQEHQELANECLLILEFVMIVVFGLEYIIRVWSAGCCCRYRGWQGRFRFARKPFCVIDFI
VFVASVAVIAAGTQGNIFATSALRSMRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELIT
AWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTITLTTIGYGDKTPHTWLGRVLA
AGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDTSRA
YLTATWYYYDSILPSFRELALLFEHVQRARNGGLRPLEVRRAPVPDGAPSRYPPVATCHR
PGSASFCPGESSRMGIKDRIRMGSSQRRTGPSKQHLAPPPMATSPSSEQVGEATSPTKVQ
KSWSFNDRTRFRASLRLKPRASAEEGPSEDVAEEKSYQCELTVDEVMPAVKTVIRSVRIL
KFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQARVDQIVGRGPGDRKAREKG
DKGPSDTEAVDEISMMGRVVKVEKQVQSIEHKLDVLLGFYSRCLRSGTSASLGTVQVPLF
DPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggccgaggcccccccgcgccgcctcggcnctggcccccccgccggggacgccccccgc
gctgagctggtggcgctcacggctgtgcagagcgagcaggggcgaggcgggcggggcggc
tccccgcgccgcctcggcctcctgggcagccccctgccgccgggcgcgcccctcccgggg
ccgggctcaggctcgggctccgcctgcggccagcgctcctccgctgcgcacaagcgctac
cgccgcctgcagaactgggtctacaacgtgctggaacgacctcgcggctgggccttcgtc
taccacgtcttcatatttttgctggtgttcagctgcctggtgctgtccgtgctttccact
atccaggagcaccaggaacttgccaatgagtgtctcctcatcttggagtttgtgatgatc
gtggtgtttggcctggagtacatcatccgcgtctggtccgctggatgctgctgccgctac
cgaggatggcagggccgcttccgctttgccagaaaacccttctgtgtcatcgacttcatc
gtgttcgtggcctcagtggctgtcatcgccgcgggcacgcagggcaacatcttcgccacg
tctgcgttgcgcagcatgcgcttcctgcagatcctgcgcatggtgcgcatggaccgccgc
ggcggcacctggaagctgctgggctccgtggtttacgcgcacagcaaggagctgatcacc
gcctggtacattgggttcctggtgctcatctttgcctccttcctggtctatctggccgag
aaagacgccaactctgacttctcctcctacgccgactcgctctggtggggaacgattaca
ctgacgaccatcggctatggtgacaagacgcctcacacgtggctgggcagggtcctggct
gctggcttcgccttactaggcatctctttctttgccttgcctgctggcatcctgggatct
ggctttgccctgaaggtgcaggagcagcaccggcagaagcactttgagaagcggaggatg
ccagcggccaacctcatccaggctgcatggcgcctgtactctaccgacacaagtcgggcc
tacctgacagccacctggtactactacgacagtatcctcccatccttcagagagctggcc
ctcttgtttgagcacgtgcaacgggcccgcaatgggggcctacggcccctggaggtgcgg
cgggcgccggtacctgatggagcaccctcccgttacccgcccgttgccacctgccaccgg
ccgggcagcgcctccttctgccctggggaaagcagccggatgggcatcaaagaccgcatt
cgcatgggcagttcccagcggcggacgggcccctccaagcagcacctggcaccgccacca
atggccacctccccgagcagcgagcaggtgggtgaggccaccagccccaccaaagtgcag
aagagctggagcttcaatgaccgcacccgcttccgggcctcactgagactcaaaccccga
gcttctgctgaggagggcccctcggaggatgtggcagaggagaagagctaccagtgtgag
ctcacagtggacgaagtcatgcccgctgtgaagacggtcatccgctccgtcaggatcctg
aagttcctggtggccaaaaggaaattcaaggagaccctgcgaccgtacgacgtgaaggac
gtcatcgagcagtactcagctgggcatctggacatgctgggccggatcaagagcctgcag
gctcgggtggaccagattgtgggcaggggtcccggggaccggaaggcgcgggagaaaggc
gacaaggggccctcggacacggaggcggtggatgaaatcagtatgatgggacgcgtggtc
aaggtggagaagcaggtgcagtccatcgagcacaaactggacgtgctgttgggtttctac
tctcgctgcctgcgctctggcacctcggctagcctgggcaccgtgcaagtgccgctcttc
gacccggacatcacctcggactaccacagtcctgtggaccacgaggacatctccgtctcc
gcacagacgctcagcatctcccgctcggtcagcaccaacatggactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509262
Entry
107509262         CDS       T06036                                 

Gene name
KCNQ5
Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 5
  KO
K04930  potassium voltage-gated channel KQT-like subfamily member 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107509262 (KCNQ5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107509262 (KCNQ5)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   107509262 (KCNQ5)
SSDB
Motif
Pfam: KCNQ_channel Ion_trans Ion_trans_2
Other DBs
NCBI-GeneID: 107509262
NCBI-ProteinID: XP_015997147
LinkDB
Position
Unknown
AA seq 818 aa
ICHDKTSFSSEFSFLLFFSFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLE
FIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSL
RFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKE
FSTYADALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKV
QEQHRQKHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKKEQGETS
SSQKLSFKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFR
PSLRLKSSQPKPVIDADTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAK
RKFKETLRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGKGQITSDKKSREKITAEH
ETTDDLSMLGRVVKVEKQVQSIESKLDCLLDIYQQVLRKGSASALTLASFQIPPFECEQT
SDYQSPVDSKDLSSSAQNSGCLTRSASANISRGLQFILTPNEFSAQTFYALSPTMHSQTT
QVPMSQSDGSAVAATNNIANQINAAPKPAAPTTLQIPPPLPAIKHLPRPETLHPNPPGLQ
ESISDVTTCLVASKENVQVAQSNLTKDRSLRKSFDMGGETLLSVHPVGPKDLGKSLSVQN
LIRSTEELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEAGPEETETDAFDALPQPAR
ETALASDSLRTGRSRSSQSICKAGESTDALSLPHVKLK
NT seq 2457 nt   +upstreamnt  +downstreamnt
atctgccatgataagacaagcttctcatcagaattctcttttttgttgtttttcagcttt
ctccttgtatttggttgcttgattttgtcagtattttccaccatccctgaacacacgaaa
ttggcctcaagttgcctcttgattctggagttcgtgatgattgttgtatttggtttggag
ttcatcattcgcatctggtctgcaggttgttgttgtcgatatagaggatggcaaggaaga
ctgaggtttgcccgaaagcccttctgtgttatagataccattgttctaatcgcttcaata
gcagttgtttctgcaaaaactcagggtaatatttttgccacgtccgcactcagaagtctc
cgtttcctacagatcctccgtatggtgcgcatggatcgaaggggaggcacttggaaatta
ctaggttcagtggtttatgctcacagcaaggaattaatcacagcttggtacataggattt
ttggttcttattttttcatctttcctcgtctatctggtggaaaaggacgccaataaagaa
ttttctacatatgcagatgctctgtggtggggcacaattacactgacaacgattggctat
ggagacaaaactcccctaacttggctgggaagattgctttctgcaggctttgcgctcctt
ggcatttctttctttgcacttcctgccggcattcttggctcaggttttgcattaaaagta
caagaacagcaccgccagaaacactttgagaaaagaaggaacccagctgccaacctaatt
cagtgcgtttggcgtagttatgcagctgatgagaaatctgtttccattgcaacctggaag
ccacacttgaaggccttgcacacctgcagccctaccaagaaagaacaaggggaaacatca
agcagtcagaagctaagttttaaggagcgagtgcgcatggctagcccgagaggccagagc
attaagagcagacaagcctcggtaggcgacaggaggtccccaagcaccgacatcacagct
gagggcagccccaccaaagtgcagaagagctggagcttcaacgaccgaacccgcttccgg
ccctcactgcgcctcaaaagttctcagccaaaaccagtgatagacgctgacacagccctt
ggcactgatgatgtatatgatgaaaaaggatgccagtgtgatgtatctgtagaagacctc
accccaccacttaaaactgtcattcgagctatcagaataatgaaattccatgttgcaaaa
cggaaatttaaagaaacattacgcccatatgatgtaaaagatgtcattgaacaatactct
gctggccatctcgacatgttgtgtagaattaaaagccttcaaacacgtgttgatcaaatt
cttggaaaagggcaaatcacatcagataagaagagccgagagaaaataacggcagaacat
gagaccacagatgatctcagtatgctcggccgggtggtcaaggttgaaaaacaggtacag
tccattgaatccaagctggactgcctactagacatatatcaacaggttctccggaaaggc
tctgcttcagccctcactttggcctcattccagatcccacctttcgaatgtgaacagaca
tctgactatcaaagccccgttgacagcaaggacctgtccagttctgcacagaacagtggc
tgcttaaccagatcagctagtgccaacatctctcgtggcctgcagttcattctgacgcca
aatgagttcagcgctcagactttctacgcgcttagccctactatgcacagtcaaactaca
caggtgccaatgagtcaaagcgatggctctgcagtggcagccaccaacaatattgcaaac
caaataaacgcggcacctaagccggcagccccaacaactttacagatcccgcctcccctc
ccagccatcaagcatctgcccaggccagagaccctgcacccaaaccccccaggcttacag
gaaagcatttcagatgtcaccacctgccttgttgcttccaaggaaaatgttcaggttgca
cagtcgaatctgaccaaggaccgttctttgaggaaaagctttgacatgggaggagaaact
ctgttgtcagtccaccccgtggggcccaaggacttgggcaaatctttgtctgtacaaaac
ttgatcaggtcgacagaggaactgaatatacagctttcagggagcgagtcaagtggctcc
agaggcagccaagatttttatcccaaatggagggaatccaaattgtttataactgacgaa
gaggcgggtccggaagagactgagacagacgctttcgatgctctgccgcagccggccagg
gaaactgctttggcgtcagactctctaaggactggaagatcgcgatcatctcagagcatt
tgtaaggccggagaaagtacggatgccctcagcttgcctcatgtcaaactgaaataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510275
Entry
107510275         CDS       T06036                                 

Gene name
KCNJ2
Definition
(RefSeq) inward rectifier potassium channel 2 isoform X1
  KO
K04996  potassium inwardly-rectifying channel subfamily J member 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04725  Cholinergic synapse
ray04921  Oxytocin signaling pathway
ray04924  Renin secretion
ray04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107510275 (KCNJ2)
   04924 Renin secretion
    107510275 (KCNJ2)
  09154 Digestive system
   04971 Gastric acid secretion
    107510275 (KCNJ2)
  09156 Nervous system
   04725 Cholinergic synapse
    107510275 (KCNJ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107510275 (KCNJ2)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107510275 (KCNJ2)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 107510275
NCBI-ProteinID: XP_015999118
LinkDB
Position
Unknown
AA seq 478 aa
MPPCAPTSTPCPHAPAPATGPVLWMSAELLRVLQKLRLFSKAEALASTAEAMGSVRTNRY
SIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFINVGEKGQRYL
ADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDAAKESKACVSEVKSF
TAAFLFSIETQTTIGYGFRCVTDECPVAVFMVVFQSIVGCIIDAFIIGAVMAKMAKPKKR
NETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEGEYIPLDQID
INVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEGMVEATAMTT
QCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARDLAEKKYILS
NANSFCYENEVALTSKEEDDSENGVPESTSTDTPPGMDLHNQASVPLEPRPLRRESEI
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgcctccgtgtgcccctacttccactccatgtccccatgctcctgcgccggcaacaggg
cctgttctctggatgtcagctgagttactaagggttttgcaaaaactcagactgttttcc
aaagcagaagcactggcgtccacagcagaagccatgggcagcgtgcgaaccaaccgctac
agcattgtctcttcggaggaagacggcatgaagctggccaccatggcggttgcaaacggc
tttgggaacgggaagagtaaggtccacacgcggcagcagtgccggagccgcttcgtgaag
aaggacggccactgcaacgttcagttcatcaacgtgggcgagaagggacaacggtacctc
gcagacatctttaccacgtgcgtggacattcgctggcggtggatgctggttatcttctgc
ctggcttttgttctctcgtggctgttctttggctgtgtgttttggttgatagctctgctc
catggggatctggatgcagccaaagagagcaaagcttgtgtatccgaggtcaagagtttc
acggccgccttccttttctccattgagacccagacgaccataggctatggtttccggtgt
gtgacggacgagtgcccggttgccgttttcatggtggtgttccagtcgatcgtgggctgc
atcatcgatgccttcatcattggcgcggtcatggcgaagatggcaaaaccaaagaagaga
aacgagactctcgtcttcagtcacaacgccgtgatcgccatgagagatggcaagctgtgt
ctgatgtggcgcgtgggcaatcttcggaaaagccacctggtggaagctcacgttcgggcg
cagctgctcaaatccagaattacttcggaaggggagtacatccccctggatcagatagat
atcaacgtcgggttcgacagtggcattgatcgtatcttcctggtgtccccaatcacgata
gtccatgaaatagatgaagacagccccttatatgatctgagtaaacaggacatcgacaac
gcagactttgagattgtcgtgatactggaaggcatggtggaggccaccgccatgacgaca
cagtgtcgcagctcgtacctggccaacgaaatcctctggggccaccgctatgagcccgta
ctctttgaagagaagcattactacaaagtggactattcgcgattccacaagacttacgaa
gtacccaacacgcccctttgtagtgctagagacttagcagaaaagaaatatatcctctca
aatgctaattcattttgctatgaaaatgaagttgccctcacgagcaaagaggaagatgac
agtgaaaacggagttccagaaagcacgagtacggacacaccccccggcatggacctgcac
aaccaggccagcgtacctctagagcccaggcccttacggcgagagtcggagatatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519298
Entry
107519298         CDS       T06036                                 

Gene name
KCNJ4
Definition
(RefSeq) inward rectifier potassium channel 4
  KO
K04998  potassium inwardly-rectifying channel subfamily J member 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04725  Cholinergic synapse
ray04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107519298 (KCNJ4)
  09156 Nervous system
   04725 Cholinergic synapse
    107519298 (KCNJ4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107519298 (KCNJ4)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107519298 (KCNJ4)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2 DUF92
Other DBs
NCBI-GeneID: 107519298
NCBI-ProteinID: XP_016017292
LinkDB
Position
Unknown
AA seq 444 aa
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
IFSAAFLVSWLFFGLLFWCIAFFHGDLEAGPAVAAAGSPAGGSGAAPATPKPCIMHVNGF
LGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKR
AQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRD
LNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTT
QARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVL
PAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGS
HLDLERMQATLPLDNVSYRRESAI
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgcacgggcacagccgcaacgggcaggcccacgtgccccggcggaaacgccgcaaccgc
ttcgtcaagaagaacggccaatgcaacgtctacttcgccaacctgagcaacaagtcgcag
cgctacatggcggacatcttcaccacctgcgtggacacgcgttggcgctacatgctcatg
atcttctccgcggcgttcctcgtctcctggctctttttcggcctcctcttttggtgcatc
gccttcttccacggtgacctggaggctggcccagcggtggccgcggcggggtccccggcg
ggtggcagcggggcggctccggcgacccccaagccgtgcatcatgcacgtgaacggcttc
ttgggtgccttcctgttctcggtggagacccagacgaccatcggctacgggttccggtgc
gtgacggaggagtgccccctggcggtcatcgccgtggtggtccagtccatcgtgggctgc
gtcatcgactccttcatgatcggcaccatcatggccaagatggcgaggcccaagaagcgg
gcgcagacgctgctgttcagccaccacgcggtcatctcggtgcgcgacggcaagctctgc
ctgatgtggcgcgtgggcaacctgcggaagagccacatcgtggaggcccacgtgcgggcc
cagctcatcaagccctacatgacccaggagggcgagtacctgccgctggaccagcgggac
ctcaacgtgggctacgacatcggcctggaccgcatcttcctggtgtcgcccatcatcatc
gtccacgagattgatgaggatagcccgctctatggcatgggcaaggaggagctggagtct
gaggactttgagattgtggtcatcctcgagggcatggtggaggccaccgccatgaccacc
caggcccgcagctcctacctggccagcgagatcctgtggggccaccgctttgagcccgtg
gtcttcgaggagaagagccactacaaggtggactactcgcgcttccacaagacctacgag
gtggccggcacgccctgctgctccgcccgggaactgcaggaaagcaagatcaccgtgctg
cctgcccccccgcccccgcccagtgccttctgctacgagaatgagctggccctcatgagc
caggaggaagaggagatggaggaggaggcggcggccgctgcggctgtggctgccggcctg
ggcttggaggcgggctccaaggaggaggcgggcatcatccgaatgctggagttcggcagc
cacctggatctggagcgcatgcaagccaccctcccgctggacaacgtctcctaccgcagg
gagtcggccatctga

DBGET integrated database retrieval system