KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498899
Entry
107498899         CDS       T06036                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04060  Cytokine-cytokine receptor interaction
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04218  Cellular senescence
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05144  Malaria
ray05145  Toxoplasmosis
ray05146  Amoebiasis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05220  Chronic myeloid leukemia
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05321  Inflammatory bowel disease
ray05323  Rheumatoid arthritis
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107498899 (TGFB3)
   04350 TGF-beta signaling pathway
    107498899 (TGFB3)
   04390 Hippo signaling pathway
    107498899 (TGFB3)
   04068 FoxO signaling pathway
    107498899 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107498899 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107498899 (TGFB3)
   04218 Cellular senescence
    107498899 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498899 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107498899 (TGFB3)
   05212 Pancreatic cancer
    107498899 (TGFB3)
   05225 Hepatocellular carcinoma
    107498899 (TGFB3)
   05226 Gastric cancer
    107498899 (TGFB3)
   05220 Chronic myeloid leukemia
    107498899 (TGFB3)
   05211 Renal cell carcinoma
    107498899 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107498899 (TGFB3)
   05321 Inflammatory bowel disease
    107498899 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107498899 (TGFB3)
   05414 Dilated cardiomyopathy
    107498899 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107498899 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107498899 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498899 (TGFB3)
   05161 Hepatitis B
    107498899 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107498899 (TGFB3)
   05144 Malaria
    107498899 (TGFB3)
   05145 Toxoplasmosis
    107498899 (TGFB3)
   05140 Leishmaniasis
    107498899 (TGFB3)
   05142 Chagas disease
    107498899 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107498899 (TGFB3)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107498899 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 107498899
NCBI-ProteinID: XP_015978049
LinkDB
Position
Unknown
AA seq 408 aa
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFSHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQILALYNSTRELLEEREDGCTQENTEWEYYAKEIHKFDMIQGLAEHNELAVCP
KGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQR
YIGGKNLPTRGTAEWLSFDVTDTVREWLSRRESNLGLEISIHCPCHTFQPNGDILENIHE
VMEIKFKGVDSEDDHGRGDLGRLRKQKDHHNPHLILMMIPPHRLDNPGQAGQRKKRALDT
NYCFSNVEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSKVLGL
YNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEHLSNMVVKSCKCS
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggacttcagccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaaactcaggctcaccagtccccctgagccatcg
gtgatgacccacgtcccctaccagatcctggccctttacaacagcacccgggagctgcta
gaggagagggaggacggctgcactcaggaaaacaccgagtgggagtactatgccaaagaa
atccataaattcgacatgatccaggggctggcggagcacaacgagctggctgtctgcccc
aaaggaatcacttccaaggttttccgcttcaacgtgtcctcagtggagaaaaatggaacc
aacctgttccgagcagaattccgggtcttgcgggtgcccaaccccagctccaagcgcaat
gagcagaggatcgagctcttccagatactccggccggatgagcatatcgccaaacagcgc
tatattggtggcaagaatctgcccacgcggggcactgccgagtggctgtcttttgatgtc
actgacactgtgcgtgaatggctctcacgaagagagtccaacttaggtctggaaatcagt
attcattgtccatgtcacacctttcagcccaatggagatatcctggaaaatattcacgag
gtgatggaaatcaaattcaaaggcgtggacagtgaggatgatcatggtcgtggagatctg
gggcgcctcaggaagcagaaagatcaccacaaccctcatcttatcctcatgatgattcct
ccacaccggcttgacaacccgggccaagcgggtcagaggaagaagcgggccctggacaca
aattactgtttcagcaacgtggaggagaactgctgtgtgcgccctctctacattgacttt
cgacaggatctgggttggaagtgggtccatgaacctaagggatattacgccaacttctgc
tcaggcccttgcccatacctccgcagtgcagacaccacccacagcaaggtgctgggcctg
tacaacaccttgaatcctgaagcatctgcctcaccttgctgtgtgccccaggacttggag
cccctgaccatcctgtactatgtcgggaggacccccaaggtggaacatctctctaatatg
gtggtgaagtcctgtaagtgtagctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505490
Entry
107505490         CDS       T06036                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04060  Cytokine-cytokine receptor interaction
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04218  Cellular senescence
ray04350  TGF-beta signaling pathway
ray04380  Osteoclast differentiation
ray04390  Hippo signaling pathway
ray04659  Th17 cell differentiation
ray04672  Intestinal immune network for IgA production
ray04926  Relaxin signaling pathway
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05144  Malaria
ray05145  Toxoplasmosis
ray05146  Amoebiasis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05220  Chronic myeloid leukemia
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05321  Inflammatory bowel disease
ray05323  Rheumatoid arthritis
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107505490 (TGFB1)
   04350 TGF-beta signaling pathway
    107505490 (TGFB1)
   04390 Hippo signaling pathway
    107505490 (TGFB1)
   04068 FoxO signaling pathway
    107505490 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107505490 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107505490 (TGFB1)
   04218 Cellular senescence
    107505490 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107505490 (TGFB1)
   04672 Intestinal immune network for IgA production
    107505490 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107505490 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107505490 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107505490 (TGFB1)
   05205 Proteoglycans in cancer
    107505490 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107505490 (TGFB1)
   05212 Pancreatic cancer
    107505490 (TGFB1)
   05225 Hepatocellular carcinoma
    107505490 (TGFB1)
   05226 Gastric cancer
    107505490 (TGFB1)
   05220 Chronic myeloid leukemia
    107505490 (TGFB1)
   05211 Renal cell carcinoma
    107505490 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107505490 (TGFB1)
   05321 Inflammatory bowel disease
    107505490 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107505490 (TGFB1)
   05414 Dilated cardiomyopathy
    107505490 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107505490 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107505490 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107505490 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107505490 (TGFB1)
   05161 Hepatitis B
    107505490 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107505490 (TGFB1)
   05144 Malaria
    107505490 (TGFB1)
   05145 Toxoplasmosis
    107505490 (TGFB1)
   05140 Leishmaniasis
    107505490 (TGFB1)
   05142 Chagas disease
    107505490 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ray03110]
    107505490 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107505490 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107505490 (TGFB1)
Chaperones and folding catalysts [BR:ray03110]
 Intramolecular chaperones
  Others
   107505490 (TGFB1)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107505490 (TGFB1)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107505490 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 107505490
NCBI-ProteinID: XP_015991163
LinkDB
Position
Unknown
AA seq 390 aa
MPPSGLRLLPLLLPLLWLLVLTPYRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPESVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLTVENSHKI
YETYKHNSHSIYMFFNTSELREAVSEPELLSRAELRMQRHKLRVEQHVELYQKYNNGSWR
YLSSQLLAPSDTPEWLSFEVTGVVRQWLSKKGEIEGFRLSAHCSCDNKDDILHVEINGIS
IGRRGDLATIHGINRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctgccgctgctgtggctactagtg
ctgacgccttaccggccggctgccggactatccacctgcaagaccatcgacatggagctg
gtgaagaggaagcgcatcgaggccatccgcggccagatcctatccaagctgcgactcgcc
agtcccccgagtcagggggaggtgccgcccggcccgctgcctgagtccgtgctggccctt
tacaacagcacccgtgaccgggtggccggggagagcgcagagccggagcccgaaccggag
gcggactactacgccaaggaggtcacccgcgtgctaaccgtggaaaacagccacaaaatc
tatgagacatacaagcataattcacacagcatatacatgttcttcaacacgtccgagctc
cgggaagcagtgtcggaacccgagttgctctcccgagcagagctgcgtatgcagagacac
aaattgagagtggagcagcatgtggagctgtaccagaaatacaacaacggttcctggcgc
tacctcagcagccagctcctggcccccagtgacacgcctgaatggttgtcctttgaggtc
actggagtagtacggcagtggctgagtaagaaaggggaaatcgagggctttcgcctcagt
gcccactgctcctgtgacaacaaagatgacatacttcatgtggaaatcaatggaatcagt
atcggccgccggggtgacctggccaccattcatggcataaaccggcccttcctgctgctc
atggccaccccgctggagagggcccagcacctgcacagttcccggcaccgccgagctctg
gacaccaactactgcttcagctccacagagaagaactgctgcgtgcggcagctttacatc
gacttccgcaaggacctgggctggaagtggatccacgagcccaagggctaccatgccaac
ttctgcctcgggccctgtccctacatttggagcctggacacacagtacagcaaggttctg
gccctgtacaaccagcacaaccccggcgcgtcggcagcgccgtgctgcgtgccgcaggcg
ctggagccgctgcctatcgtgtactacgtgggccgcaagcccaaggtcgagcagctctcc
aacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520844
Entry
107520844         CDS       T06036                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04060  Cytokine-cytokine receptor interaction
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04218  Cellular senescence
ray04350  TGF-beta signaling pathway
ray04380  Osteoclast differentiation
ray04390  Hippo signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05144  Malaria
ray05145  Toxoplasmosis
ray05146  Amoebiasis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05220  Chronic myeloid leukemia
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05321  Inflammatory bowel disease
ray05323  Rheumatoid arthritis
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107520844 (TGFB2)
   04350 TGF-beta signaling pathway
    107520844 (TGFB2)
   04390 Hippo signaling pathway
    107520844 (TGFB2)
   04068 FoxO signaling pathway
    107520844 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107520844 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107520844 (TGFB2)
   04218 Cellular senescence
    107520844 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107520844 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107520844 (TGFB2)
   05206 MicroRNAs in cancer
    107520844 (TGFB2)
   05205 Proteoglycans in cancer
    107520844 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107520844 (TGFB2)
   05212 Pancreatic cancer
    107520844 (TGFB2)
   05225 Hepatocellular carcinoma
    107520844 (TGFB2)
   05226 Gastric cancer
    107520844 (TGFB2)
   05220 Chronic myeloid leukemia
    107520844 (TGFB2)
   05211 Renal cell carcinoma
    107520844 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107520844 (TGFB2)
   05321 Inflammatory bowel disease
    107520844 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107520844 (TGFB2)
   05414 Dilated cardiomyopathy
    107520844 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107520844 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107520844 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107520844 (TGFB2)
   05161 Hepatitis B
    107520844 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107520844 (TGFB2)
   05144 Malaria
    107520844 (TGFB2)
   05145 Toxoplasmosis
    107520844 (TGFB2)
   05140 Leishmaniasis
    107520844 (TGFB2)
   05142 Chagas disease
    107520844 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107520844 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107520844 (TGFB2)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   107520844 (TGFB2)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107520844 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 107520844
NCBI-ProteinID: XP_016020553
LinkDB
Position
Unknown
AA seq 442 aa
MRRCVLSGLVGLHLVTAALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EDVPPEVLSIYNSTRDLLKEKASRRAAACERERSDEEYYAKEVYKIEMPPFYPAETVCPV
ATTPSGSVGSLCSRQSQGLCGRLDTIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVAEQRIELYQILKSKDLTSPAQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSSRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcgccgctgcgtgctgagcgggctggtggggctgcatctggtcacggccgcgctcagc
ctgtctacctgcagcacgctggacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccggaggactaccccgagccc
gaggacgtgccccccgaggtgctgtccatctacaacagcacccgcgacctgctcaaggag
aaggcgagccgccgcgcggccgcctgcgagcgcgagcgcagcgacgaggagtactacgcc
aaggaggtgtacaagatcgagatgccgcccttctaccccgccgaaactgtctgccccgtt
gccacaacaccctcgggctcagtgggcagcttgtgctccagacagtcccaggggctctgt
gggcgccttgacaccatcccgcccactttctacagaccctacttcaggatcgtgcgattc
gacgtctcagcgatggagaaaaatgcttccaatttggtgaaagcggagttcagagtcttt
cgtttacagaaccccaaagccagggtggccgaacaacgcatcgagctgtaccagattctc
aaatccaaagatttaacgtccccggcccaacgctacatcgacagcaaagtcgtgaaaacc
agagcagaaggggagtggctctccttcgatgtgacggacgccgtccacgaatggctgcac
cacaaagacagaaacctgggatttaaaataagtttacattgcccctgctgcaccttcgtt
ccgtctaacaattacatcatccccaacaaaagtgaagagctggaagcgaggttcgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacacctcctgctaatgttgttgccctcctacagactggag
tcacaacagtcctcgcggcggaagaaacgcgctctggacgcagcctattgttttaggaac
gtgcaggacaattgctgcctgcgtcctctttacattgatttcaagagggatcttgggtgg
aaatggatccatgagcccaaagggtacaacgccaacttctgcgctggggcgtgcccgtac
ctgtggagctccgacacccagcacagcagggtgctcagcttatacaacaccataaatcca
gaagcatctgcttctccctgctgcgtgtcccaggatttagagccactgaccattctctac
tacatcggcaaaacacccaagatcgaacagctttctaacatgatcgtaaagtcttgcaaa
tgcagctaa

DBGET integrated database retrieval system