KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498912
Entry
107498912         CDS       T06036                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04024  cAMP signaling pathway
ray04210  Apoptosis
ray04380  Osteoclast differentiation
ray04620  Toll-like receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04668  TNF signaling pathway
ray04713  Circadian entrainment
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04932  Non-alcoholic fatty liver disease
ray04935  Growth hormone synthesis, secretion and action
ray05031  Amphetamine addiction
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05161  Hepatitis B
ray05162  Measles
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05224  Breast cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05323  Rheumatoid arthritis
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107498912 (FOS)
   04668 TNF signaling pathway
    107498912 (FOS)
   04024 cAMP signaling pathway
    107498912 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107498912 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107498912 (FOS)
   04660 T cell receptor signaling pathway
    107498912 (FOS)
   04658 Th1 and Th2 cell differentiation
    107498912 (FOS)
   04659 Th17 cell differentiation
    107498912 (FOS)
   04657 IL-17 signaling pathway
    107498912 (FOS)
   04662 B cell receptor signaling pathway
    107498912 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107498912 (FOS)
   04917 Prolactin signaling pathway
    107498912 (FOS)
   04921 Oxytocin signaling pathway
    107498912 (FOS)
   04926 Relaxin signaling pathway
    107498912 (FOS)
   04935 Growth hormone synthesis, secretion and action
    107498912 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    107498912 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    107498912 (FOS)
   04728 Dopaminergic synapse
    107498912 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107498912 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107498912 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498912 (FOS)
   05231 Choline metabolism in cancer
    107498912 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107498912 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107498912 (FOS)
   05224 Breast cancer
    107498912 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107498912 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    107498912 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107498912 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107498912 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107498912 (FOS)
   05135 Yersinia infection
    107498912 (FOS)
   05133 Pertussis
    107498912 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498912 (FOS)
   05170 Human immunodeficiency virus 1 infection
    107498912 (FOS)
   05161 Hepatitis B
    107498912 (FOS)
   05171 Coronavirus disease - COVID-19
    107498912 (FOS)
   05162 Measles
    107498912 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107498912 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107498912 (FOS)
   05142 Chagas disease
    107498912 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107498912 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107498912 (FOS)
   04131 Membrane trafficking [BR:ray04131]
    107498912 (FOS)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    107498912 (FOS)
Membrane trafficking [BR:ray04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107498912 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ UPF0242
Other DBs
NCBI-GeneID: 107498912
NCBI-ProteinID: XP_015978079
LinkDB
Position
Unknown
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNGQDFCTDLAASSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTVTGSRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSMASLDLSGGLPEAATSESEEAFT
LPLLNDPEPKPAVEPVKNINSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPMAAELEPLCTPVVTCTPSCATYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctccggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc
tccccagccggggacagtctctcctactaccactcaccggctgattctttctccagcatg
ggctctcctgtcaacggacaggacttctgcactgatctggccgcctccagtgccaacttc
atcccaactgtgactgccatctcgaccagcccggacctgcagtggctggtgcagcctacc
ctggtctcctccgtggccccatcccagaccagagcccctcacccctatggcgttcccacc
ccctcagctggggcttactccagggctggagtcatgaagactgtgacaggaagcagagct
cagagcattggcaggaggggcaaagtggaacagttgtccccagaggaggaagagaaaagg
agaatccgtagagaaaggaataagatggctgcagccaaatgcaggaaccggaggagggag
ctgactgacacactccaagcggagacagaccaattagaagatgagaagtctgctttacag
actgaaattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctaggcttcccagaagagatgtctatggcttcc
cttgatctgagtgggggccttcctgaggctgccacctctgagtctgaggaggccttcact
ctgcccctcctcaatgaccctgagcccaagcccgcagtggagcctgtcaagaacatcaac
agcatggagctgaaggctgagccctttgatgactttcttttcccagcatcatccaggccc
agtggctctgagaccgctcgctctgtgccagacatggatctgtccggttccttctatgca
gcagactgggagcccctgcacggtggctccctggggatggggcccatggccgcagagctg
gagcccttgtgcaccccggtggtcacctgtactcccagctgcgctacttacacgtcttcc
tttgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgcaag
ggcagcagcagcaacgagccctcctctgactcactcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system