KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498912
Entry
107498912         CDS       T06036                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04024  cAMP signaling pathway
ray04210  Apoptosis
ray04380  Osteoclast differentiation
ray04620  Toll-like receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04668  TNF signaling pathway
ray04713  Circadian entrainment
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04932  Non-alcoholic fatty liver disease
ray04935  Growth hormone synthesis, secretion and action
ray05031  Amphetamine addiction
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05161  Hepatitis B
ray05162  Measles
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05224  Breast cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05323  Rheumatoid arthritis
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107498912 (FOS)
   04668 TNF signaling pathway
    107498912 (FOS)
   04024 cAMP signaling pathway
    107498912 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107498912 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107498912 (FOS)
   04660 T cell receptor signaling pathway
    107498912 (FOS)
   04658 Th1 and Th2 cell differentiation
    107498912 (FOS)
   04659 Th17 cell differentiation
    107498912 (FOS)
   04657 IL-17 signaling pathway
    107498912 (FOS)
   04662 B cell receptor signaling pathway
    107498912 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107498912 (FOS)
   04917 Prolactin signaling pathway
    107498912 (FOS)
   04921 Oxytocin signaling pathway
    107498912 (FOS)
   04926 Relaxin signaling pathway
    107498912 (FOS)
   04935 Growth hormone synthesis, secretion and action
    107498912 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    107498912 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    107498912 (FOS)
   04728 Dopaminergic synapse
    107498912 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107498912 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107498912 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107498912 (FOS)
   05231 Choline metabolism in cancer
    107498912 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107498912 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107498912 (FOS)
   05224 Breast cancer
    107498912 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107498912 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    107498912 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107498912 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107498912 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107498912 (FOS)
   05135 Yersinia infection
    107498912 (FOS)
   05133 Pertussis
    107498912 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107498912 (FOS)
   05170 Human immunodeficiency virus 1 infection
    107498912 (FOS)
   05161 Hepatitis B
    107498912 (FOS)
   05171 Coronavirus disease - COVID-19
    107498912 (FOS)
   05162 Measles
    107498912 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107498912 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107498912 (FOS)
   05142 Chagas disease
    107498912 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107498912 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107498912 (FOS)
   04131 Membrane trafficking [BR:ray04131]
    107498912 (FOS)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    107498912 (FOS)
Membrane trafficking [BR:ray04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    107498912 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ UPF0242
Other DBs
NCBI-GeneID: 107498912
NCBI-ProteinID: XP_015978079
LinkDB
Position
Unknown
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNGQDFCTDLAASSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTVTGSRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSMASLDLSGGLPEAATSESEEAFT
LPLLNDPEPKPAVEPVKNINSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHGGSLGMGPMAAELEPLCTPVVTCTPSCATYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctccggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc
tccccagccggggacagtctctcctactaccactcaccggctgattctttctccagcatg
ggctctcctgtcaacggacaggacttctgcactgatctggccgcctccagtgccaacttc
atcccaactgtgactgccatctcgaccagcccggacctgcagtggctggtgcagcctacc
ctggtctcctccgtggccccatcccagaccagagcccctcacccctatggcgttcccacc
ccctcagctggggcttactccagggctggagtcatgaagactgtgacaggaagcagagct
cagagcattggcaggaggggcaaagtggaacagttgtccccagaggaggaagagaaaagg
agaatccgtagagaaaggaataagatggctgcagccaaatgcaggaaccggaggagggag
ctgactgacacactccaagcggagacagaccaattagaagatgagaagtctgctttacag
actgaaattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctaggcttcccagaagagatgtctatggcttcc
cttgatctgagtgggggccttcctgaggctgccacctctgagtctgaggaggccttcact
ctgcccctcctcaatgaccctgagcccaagcccgcagtggagcctgtcaagaacatcaac
agcatggagctgaaggctgagccctttgatgactttcttttcccagcatcatccaggccc
agtggctctgagaccgctcgctctgtgccagacatggatctgtccggttccttctatgca
gcagactgggagcccctgcacggtggctccctggggatggggcccatggccgcagagctg
gagcccttgtgcaccccggtggtcacctgtactcccagctgcgctacttacacgtcttcc
tttgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgcaag
ggcagcagcagcaacgagccctcctctgactcactcagctcacccacgctgctggccctg
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509855
Entry
107509855         CDS       T06036                                 

Gene name
SP1
Definition
(RefSeq) transcription factor Sp1
  KO
K04684  transcription factor Sp1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04137  Mitophagy - animal
ray04350  TGF-beta signaling pathway
ray04915  Estrogen signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05224  Breast cancer
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107509855 (SP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107509855 (SP1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107509855 (SP1)
   04928 Parathyroid hormone synthesis, secretion and action
    107509855 (SP1)
   04927 Cortisol synthesis and secretion
    107509855 (SP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509855 (SP1)
   05202 Transcriptional misregulation in cancer
    107509855 (SP1)
   05231 Choline metabolism in cancer
    107509855 (SP1)
  09162 Cancer: specific types
   05224 Breast cancer
    107509855 (SP1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107509855 (SP1)
   05017 Spinocerebellar ataxia
    107509855 (SP1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107509855 (SP1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107509855 (SP1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107509855 (SP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107509855 (SP1)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107509855 (SP1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    107509855 (SP1)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    107509855 (SP1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 107509855
NCBI-ProteinID: XP_015998213
LinkDB
Position
Unknown
AA seq 790 aa
MSDQDHSMDEMTAVVKIEKGVGGSNGGNGNGSGAFSQARSSSTGSSSSSGGGGGGGGQES
QPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGA
TPTSKEQSGSSTNGSNGSEPSKNRTVSGGQYVVAATSNLQNQQVLTGLPGVMPNIQYQVI
PQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAV
PLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESSS
QPVTSGTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTTSGSAGTNSQGQT
PQRVSGLQGSDALNMQQNQTSGGSLQASQQKEGEQNQQSQQQQILIQPQLVQGGQTLQAL
QAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQ
NPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLS
ALGASGIQVHQLPSLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDPQPQA
GRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIPGCGKVYGKTSHLRAHLRWHTGERP
FICTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGP
GVALSVGTLPLDSGAGSEGSGATTSSALIATNMVAMEAICPEGIARLANSGINVMQVADL
QSINISGNGF
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaaatgacagccgtggtgaagattgaaaaaggt
gttggtggcagtaatgggggcaatggtaatggtagtggtgccttttcccaggctcgaagc
agcagcacgggcagcagcagcagcagtggaggaggaggaggaggaggaggacaggaatcc
cagccatcccctttggctctgctggcagcaacttgcagcagaattgaatcacctaatgaa
aacagcaacaactcccagggcccaagccagtcagggggcacaggtgagcttgaccttaca
gccacacaactctcacagggtgccaatggctggcagatcatctcttcctcctctggggct
acccctacctcaaaggaacagagtggcagcagtaccaatggcagcaatggcagtgagcct
tccaagaatcgcacagtctctggtgggcagtacgttgtggctgccacttccaacttacag
aaccagcaagttctgacaggactgcctggagtgatgcctaatattcagtatcaagtaatc
ccacagttccagactgttgatgggcaacagctgcagtttgctgccactggggcccaagtg
cagcaggatggttctggtcaaatacagatcataccaggtgcaaaccagcagatcatcaca
aatcgtggaagtggaggcaacatcattgctgctatgccaaatctactccagcaagctgtc
cccctccaaggcctggctaataatgtactctcaggacagactcagtatgtgaccaatgta
ccagtggccctgaatgggaatatcaccttgctacccgtcaacagcgtttctgcagctacc
ttgactcctagctctcaggcagtcacgatcagcagctctgggtcccaggagagcagctca
cagcctgtcacctcagggactgccatcagttctgccagtttggtatcatcacaagccagt
tccagctcctttttcaccaatgccaatagctattcaacaactactaccaccagcaatatg
ggaattatgaactttaccaccaccagcggatcagcagggaccaactctcaaggccagaca
ccccagagggtcagtgggctacaggggtctgatgctctgaacatgcagcagaaccagaca
tctggaggctcactgcaagcaagtcagcaaaaagagggagagcaaaaccagcagtcacag
caacaacaaattcttatccagcctcagctagttcaagggggacagaccctccaggccctt
caggcagcaccattgtcagggcagaccttcacaactcaagctatctcccaggaaaccctc
cagaatctccagcttcaggctgttccaaactctggtcccatcatcatccggacaccaaca
gtggggcccaatggacaggtcagttggcagactcttcagctgcaaaacctccaagttcag
aacccacaggcccagacaatcaccttggccccaatgcagggtgtttccctggggcagacc
agcagcagtaataccacccttacacccattgcctcagctgcctctatccctgccggcaca
gtcactgtgaatgctgctcaactctcctccatgcctggcctccagaccataaacctcagt
gcattgggtgcttcaggaatccaggtgcaccagcttccaagcctgccgttagctatagca
aatgccccaggtgatcacggagctcagcttggcctccatggagctggtggtgatggaata
catgatgacacagcagggggagaggaaggagagaacagcccagatccccaaccccaggca
ggtcggaggacccggcgggaagcatgcacctgcccctactgtaaagacagtgaaggaagg
ggctcaggggatcctggcaaaaagaaacagcatatttgccacattccaggctgtggcaaa
gtatatggcaagacctcacacctacgggcacacttgcgctggcatacaggcgagagacca
tttatatgtacctggtcatactgtgggaaacgcttcacacgttcggatgagctacagagg
cacaaacgcacacacacaggtgaaaagaaatttgcctgtcctgagtgtcccaagcgcttc
atgaggagtgaccacctgtcaaagcatatcaagacccaccagaataagaagggaggccca
ggtgtagccctgagtgtgggcactttgcccctggacagtggggcaggttcagaaggcagt
ggcgctaccacttcttcggcccttattgctaccaatatggtagctatggaggccatctgt
ccagagggtattgcccgtcttgccaacagtggcatcaacgttatgcaggtggcagatctg
cagtccattaatatcagtggcaatggcttctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518352
Entry
107518352         CDS       T06036                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04024  cAMP signaling pathway
ray04137  Mitophagy - animal
ray04210  Apoptosis
ray04310  Wnt signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04530  Tight junction
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04668  TNF signaling pathway
ray04722  Neurotrophin signaling pathway
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05132  Salmonella infection
ray05133  Pertussis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05142  Chagas disease
ray05161  Hepatitis B
ray05162  Measles
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05224  Breast cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05321  Inflammatory bowel disease
ray05323  Rheumatoid arthritis
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107518352 (JUN)
   04012 ErbB signaling pathway
    107518352 (JUN)
   04310 Wnt signaling pathway
    107518352 (JUN)
   04668 TNF signaling pathway
    107518352 (JUN)
   04024 cAMP signaling pathway
    107518352 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107518352 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    107518352 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107518352 (JUN)
   04530 Tight junction
    107518352 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107518352 (JUN)
   04621 NOD-like receptor signaling pathway
    107518352 (JUN)
   04625 C-type lectin receptor signaling pathway
    107518352 (JUN)
   04660 T cell receptor signaling pathway
    107518352 (JUN)
   04658 Th1 and Th2 cell differentiation
    107518352 (JUN)
   04659 Th17 cell differentiation
    107518352 (JUN)
   04657 IL-17 signaling pathway
    107518352 (JUN)
   04662 B cell receptor signaling pathway
    107518352 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107518352 (JUN)
   04915 Estrogen signaling pathway
    107518352 (JUN)
   04921 Oxytocin signaling pathway
    107518352 (JUN)
   04926 Relaxin signaling pathway
    107518352 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107518352 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107518352 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518352 (JUN)
   05203 Viral carcinogenesis
    107518352 (JUN)
   05231 Choline metabolism in cancer
    107518352 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107518352 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107518352 (JUN)
   05211 Renal cell carcinoma
    107518352 (JUN)
   05224 Breast cancer
    107518352 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107518352 (JUN)
   05321 Inflammatory bowel disease
    107518352 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    107518352 (JUN)
   05031 Amphetamine addiction
    107518352 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107518352 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107518352 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107518352 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107518352 (JUN)
   05135 Yersinia infection
    107518352 (JUN)
   05133 Pertussis
    107518352 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107518352 (JUN)
   05170 Human immunodeficiency virus 1 infection
    107518352 (JUN)
   05161 Hepatitis B
    107518352 (JUN)
   05171 Coronavirus disease - COVID-19
    107518352 (JUN)
   05162 Measles
    107518352 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107518352 (JUN)
   05169 Epstein-Barr virus infection
    107518352 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107518352 (JUN)
   05142 Chagas disease
    107518352 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107518352 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107518352 (JUN)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    107518352 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 TFIIA FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 107518352
NCBI-ProteinID: XP_016015412
LinkDB
Position
Unknown
AA seq 335 aa
MTAKMETTFYDDTLLNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSD
LLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALA
ELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGGSGSSGFSASLHSEPPVYANLSNFNPG
ALSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMP
GETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAS
TANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatacccttcttaacgcctcgttcctc
cagtccgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagcatgacc
ctgaacctggccgacccggtgggcagcctgaagccacacctccgggccaagaactcggac
ctcctcacctcgcccgatgtgggactgctcaaactggcgtcgccagagctggagcgccta
ataatccagtccagcaacgggcacatcaccaccacgccgacccccacccagtttctgtgc
cccaagaacgtgacggacgagcaggagggcttcgctgagggcttcgtgcgcgccctggcc
gaactgcacagccagaacacgctgcccagcgtcacgtccgcggcgcagccggtcagcggc
gccggcatggtggctcccgcagtggcttccgtggcgggcggcagcggcagcagcggcttc
agcgccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccaggc
gcgctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcg
cagccccagcagcagcaacagccaccgcagccgccgcaccacctgccccagcagatcccc
gtgcagcacccgcggctgcaagccctgaaggaggagccgcagacggtccccgagatgccc
ggggaaacgccgcccctgtcccctatcgacatggagtcccaagagcggatcaaggcggag
aggaagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagagg
atcgccaggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtcc
acggccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgtt
aacagtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system