KEGG   Rousettus aegyptiacus (Egyptian rousette): 107498959
Entry
107498959         CDS       T06036                                 

Gene name
RGS2
Definition
(RefSeq) regulator of G-protein signaling 2
  KO
K18154  regulator of G-protein signaling 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04740  Olfactory transduction
ray04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107498959 (RGS2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107498959 (RGS2)
  09157 Sensory system
   04740 Olfactory transduction
    107498959 (RGS2)
SSDB
Motif
Pfam: RGS
Other DBs
NCBI-GeneID: 107498959
NCBI-ProteinID: XP_015978161
LinkDB
Position
Unknown
AA seq 211 aa
MQSAMFLAVQHDCGSMDKSSGSSSKSEEKREKMKRTLLKDWKTRLSYFLQHSSSPGKPKT
GKKSKQQTFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITSEPHAT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaaagtgccatgttcctggctgtccagcacgactgtggctccatggacaagagctca
ggcagcagctccaaaagcgaggagaagcgggaaaaaatgaagcggaccctattaaaagat
tggaagacccgtttgagctacttcttgcaacattcttcctctcctgggaagcccaaaact
ggcaagaaaagcaaacagcaaaccttcatcaagccttctcctgaggaagcacagctgtgg
tcagaagcatttgatgagctgctagccagtaaatatggtcttgctgcgttcagggctttc
ttaaaatctgagttctgtgaagaaaatattgaattctggctggcctgtgaagacttcaaa
aaaaccaagtcaccccaaaagttgtcctcgaaagcaagaaaaatatatactgacttcata
gaaaaagaagctccaaaagagataaatatagactttcaaaccaaaactctaattgcccaa
aatatacaagaggctacaagtggctgctttacaactgcccagaaaagggtatacagcttg
atggagaacaactcttatccccgtttcttggagtcagaattctaccaggacttgtgtaaa
aagccacagatcacctcagagccccatgctacatga

DBGET integrated database retrieval system