KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499057
Entry
107499057         CDS       T06036                                 

Gene name
CREB3L2
Definition
(RefSeq) LOW QUALITY PROTEIN: cyclic AMP-responsive element-binding protein 3-like protein 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04668  TNF signaling pathway
ray04714  Thermogenesis
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04911  Insulin secretion
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04922  Glucagon signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04931  Insulin resistance
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04962  Vasopressin-regulated water reabsorption
ray05016  Huntington disease
ray05020  Prion disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05203  Viral carcinogenesis
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107499057 (CREB3L2)
   04024 cAMP signaling pathway
    107499057 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    107499057 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    107499057 (CREB3L2)
   04152 AMPK signaling pathway
    107499057 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107499057 (CREB3L2)
   04922 Glucagon signaling pathway
    107499057 (CREB3L2)
   04915 Estrogen signaling pathway
    107499057 (CREB3L2)
   04926 Relaxin signaling pathway
    107499057 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    107499057 (CREB3L2)
   04918 Thyroid hormone synthesis
    107499057 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    107499057 (CREB3L2)
   04916 Melanogenesis
    107499057 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    107499057 (CREB3L2)
   04927 Cortisol synthesis and secretion
    107499057 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107499057 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107499057 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    107499057 (CREB3L2)
   04728 Dopaminergic synapse
    107499057 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    107499057 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    107499057 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107499057 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    107499057 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107499057 (CREB3L2)
   05020 Prion disease
    107499057 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    107499057 (CREB3L2)
   05031 Amphetamine addiction
    107499057 (CREB3L2)
   05034 Alcoholism
    107499057 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107499057 (CREB3L2)
   04934 Cushing syndrome
    107499057 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107499057 (CREB3L2)
   05161 Hepatitis B
    107499057 (CREB3L2)
   05163 Human cytomegalovirus infection
    107499057 (CREB3L2)
   05165 Human papillomavirus infection
    107499057 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107499057 (CREB3L2)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107499057 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAUS6_N JMY HAUS-augmin3
Other DBs
NCBI-GeneID: 107499057
NCBI-ProteinID: XP_015978360
LinkDB
Position
Unknown
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGESEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
SVSMEVEPSPTSPAPLIQAEHSYSLCEEPRVQSPFTHVTSSDSFNDDDVESEKWYLCTDF
PSATIKTEPITDEPPPGLVPSVTLTITAISTPLEKVEPPLEMNTVVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEGSMDHLHLPPTPPSSHSSDSEGSLSPSPRLHPFGPAQAHSAARAVV
RAPSTLSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSVPEPYT
ASIVRSRNLLIYEEHSPLEEPSSPASAGELGRWDRGSALLRASGLEPXPDMDLPHFILAN
ETSLEKSVLLELQQHLVGAKLEGNETLKVVELDRRVNATF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctgtcagagcccggggaaagcgaggctctcatgtatcacacgcacttctcagaactcctg
gatgagttttcccagaatgtcttgggtcagctcctgaacgatcccttcctctcggagaaa
agcgtgtcgatggaggtggagccgtcgccgacatccccagcgcctctcatacaggccgag
cacagctactcgctgtgcgaggagcctcgggtccagtcaccattcacccacgtcaccagc
agtgacagcttcaacgatgatgatgtggaaagcgagaaatggtacctgtgcacagacttt
ccttcagcaaccatcaagaccgagccgatcacggatgagccccccccggggcttgttccc
tctgtcactttgaccatcacagccatctccactccgttagagaaggtggaacctcctctg
gaaatgaatactgtggtggattcgtcgtgccagaccattattcctaagatcaagctggag
cctcacgaagtggatcagttcctgaacttctctcccaaggaaggctccatggaccacctg
cacctaccgcccacccctcccagcagccacagcagtgactcggagggcagcctgagcccc
agcccgcgcctgcaccccttcggcccggcgcaggcgcacagtgcagcccgagccgtggtg
cgggccccctccacactttccagttccccgctgctcacagccccccacaaactgcagggg
tcaggcccgctggtcctgacggaggaggagaagaggaccctgatcgccgagggctacccc
atccccaccaaactgcctctgacaaaatcagaggagaaggccctgaagaaaatccggagg
aaaatcaagaataagatttctgcccaggaaagtaggagaaagaagaaagaatacatggac
agcttggagaaaaaggtggagtcctgttcaactgagaacttggagcttcggaagaaggtc
gaggttctggagaataccaacagaactctcctccagcaactgcagaagcttcagactttg
gtgatgggcaaggtttctcgcacctgcaagttggctggcacgcagaccggcacctgcctc
atggtcgtggtgctatgctttgccgtggcctttggcagcttctttcagggctatgggccc
tacccttctgccaccaagatggccctgcccagccagcattccgtgccggagccgtacaca
gcctccatcgtgaggtccaggaacctgctcatctacgaggagcactctccgctggaggag
ccgtccagcccggcctcggccggggagctcgggcgctgggaccgaggctctgccctgctc
agggcatcggggctggagcccncgccagacatggacctcccccatttcattctcgcgaat
gagaccagcctggagaagtcggtgctgctggagctgcagcagcacttggtcggcgccaaa
ctggaggggaacgaaacactaaaggtcgtagagctcgacagaagagtgaacgccaccttc
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500816
Entry
107500816         CDS       T06036                                 

Gene name
ATF4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04137  Mitophagy - animal
ray04141  Protein processing in endoplasmic reticulum
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04211  Longevity regulating pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04668  TNF signaling pathway
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04918  Thyroid hormone synthesis
ray04922  Glucagon signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04932  Non-alcoholic fatty liver disease
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05203  Viral carcinogenesis
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107500816 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107500816 (ATF4)
   04668 TNF signaling pathway
    107500816 (ATF4)
   04022 cGMP-PKG signaling pathway
    107500816 (ATF4)
   04151 PI3K-Akt signaling pathway
    107500816 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107500816 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    107500816 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107500816 (ATF4)
   04922 Glucagon signaling pathway
    107500816 (ATF4)
   04912 GnRH signaling pathway
    107500816 (ATF4)
   04915 Estrogen signaling pathway
    107500816 (ATF4)
   04926 Relaxin signaling pathway
    107500816 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    107500816 (ATF4)
   04918 Thyroid hormone synthesis
    107500816 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    107500816 (ATF4)
   04925 Aldosterone synthesis and secretion
    107500816 (ATF4)
   04927 Cortisol synthesis and secretion
    107500816 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107500816 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    107500816 (ATF4)
   04728 Dopaminergic synapse
    107500816 (ATF4)
   04720 Long-term potentiation
    107500816 (ATF4)
   04722 Neurotrophin signaling pathway
    107500816 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    107500816 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107500816 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    107500816 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107500816 (ATF4)
   05012 Parkinson disease
    107500816 (ATF4)
   05014 Amyotrophic lateral sclerosis
    107500816 (ATF4)
   05020 Prion disease
    107500816 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    107500816 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    107500816 (ATF4)
   05031 Amphetamine addiction
    107500816 (ATF4)
   05034 Alcoholism
    107500816 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107500816 (ATF4)
   04934 Cushing syndrome
    107500816 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107500816 (ATF4)
   05161 Hepatitis B
    107500816 (ATF4)
   05163 Human cytomegalovirus infection
    107500816 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107500816 (ATF4)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    107500816 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 DUF3450 Laminin_II Nop53 Fez1 bZIP_Maf Baculo_F AAA_13 ZapB
Other DBs
NCBI-GeneID: 107500816
NCBI-ProteinID: XP_015981937
LinkDB
Position
Unknown
AA seq 351 aa
MTEMSFLNSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKHHGFSGDKAKAGSSE
WLAVEGLVSASDSGKEDAFTGTDWMVEKMDLKEFDFDSLLSLDDLETMPDELLATLDETC
DLFDPVVQETTKDAPQTANQIGHLSESLPKTDQVAPFTFLQPLPFCPGVLCSTPDHSFSL
ELGSEVDISEGDKKSDSTAYITVVPQCIKEEDATSDNDSGICMSPESYPGSPQQSPSTSR
ASPNRSLLSPATLCGSARPKPYDPPGEKAVAKGKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRAP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgaccgagatgagcttcctgaacagcgaggtgttggtgggggacttgatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagacgactacctggaggtg
gccaagcacttcaaacatcatggattctccggcgacaaggctaaggctggctcctccgaa
tggctggctgtggaggggttggtcagtgcctcagacagcggcaaggaggatgccttcacc
gggacagattggatggtggagaaaatggatctcaaggagtttgattttgattctctgtta
agtttagatgatctggaaactatgcccgatgagcttttggccacgttggatgagacgtgt
gatctctttgaccccgtagtccaggagactactaaggatgccccacagacagcaaaccaa
attggccatctctcagaaagtttaccaaaaaccgaccaggttgcccccttcaccttcctg
caacctcttcccttttgtccaggggttttgtgttctactccagatcattcctttagctta
gaattaggcagtgaagttgatatctctgaaggagataagaaatcggactccactgcttac
attactgtggtccctcagtgcataaaggaggaggatgccacttcagataacgatagtggc
atctgtatgagccctgagtcctatccaggttctccccagcaaagcccctctacttctagg
gcctctccaaataggagccttctgtctccagctaccctctgtggctctgcccgccccaaa
ccctatgaccctcctggtgagaaggcggtagcaaaaggaaagggtgagaaattggataag
aaactgaaaaaaatggagcagaacaagacagcagccactagataccgccagaagaagagg
gcagagcaggaagctctcactggtgaatgtaaagagctggaaaagaagaatgaggctctg
aaagagaaggcagattccttggccaaggagatccagtacctgaaagatttgatagaagag
gtccgtaaggcaaggggcaagaaaagggccccctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502779
Entry
107502779         CDS       T06036                                 

Gene name
CREB3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04668  TNF signaling pathway
ray04714  Thermogenesis
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04911  Insulin secretion
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04922  Glucagon signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04931  Insulin resistance
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04962  Vasopressin-regulated water reabsorption
ray05016  Huntington disease
ray05020  Prion disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05203  Viral carcinogenesis
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107502779 (CREB3)
   04024 cAMP signaling pathway
    107502779 (CREB3)
   04022 cGMP-PKG signaling pathway
    107502779 (CREB3)
   04151 PI3K-Akt signaling pathway
    107502779 (CREB3)
   04152 AMPK signaling pathway
    107502779 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107502779 (CREB3)
   04922 Glucagon signaling pathway
    107502779 (CREB3)
   04915 Estrogen signaling pathway
    107502779 (CREB3)
   04926 Relaxin signaling pathway
    107502779 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    107502779 (CREB3)
   04918 Thyroid hormone synthesis
    107502779 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    107502779 (CREB3)
   04916 Melanogenesis
    107502779 (CREB3)
   04925 Aldosterone synthesis and secretion
    107502779 (CREB3)
   04927 Cortisol synthesis and secretion
    107502779 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107502779 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107502779 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    107502779 (CREB3)
   04728 Dopaminergic synapse
    107502779 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    107502779 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    107502779 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107502779 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    107502779 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107502779 (CREB3)
   05020 Prion disease
    107502779 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    107502779 (CREB3)
   05031 Amphetamine addiction
    107502779 (CREB3)
   05034 Alcoholism
    107502779 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107502779 (CREB3)
   04934 Cushing syndrome
    107502779 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107502779 (CREB3)
   05161 Hepatitis B
    107502779 (CREB3)
   05163 Human cytomegalovirus infection
    107502779 (CREB3)
   05165 Human papillomavirus infection
    107502779 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107502779 (CREB3)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107502779 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB Fer4_14
Other DBs
NCBI-GeneID: 107502779
NCBI-ProteinID: XP_015985775
LinkDB
Position
Unknown
AA seq 362 aa
MELALDPGDQDLLGFLLEESGDLGVVPNEAMEAPVNWELPLSQALSDWDIEDFLSSLQSP
PASLSVLSNSNPCLVHHDHTYSLPQEHVSIGLDSESCGEEGALIPLHVEEPSEQEMVRLI
LTDEEKRLLEQEGITLPGTFPLTKMEEQVLKRVRRKIRNKRSAQESRRKKKVYVGSLESR
VLKYTAQNLELQNKVQLLEEQNLSLLDQLRRLQAMVVQIANKTSSSSTCVLVLLFSFCLL
LVPAMYSSDTRGRLPAEHGVLSRQLRGLSEDPHQLELPALQPEVPKNNSDRELQAPDNSC
LLYHMPQAPGTEPPMKLPLLDHFSKSPHPDPILYLHANLTREGEWLPAHSSVCVILQGRH
SG
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggagttggcgttggacccgggtgaccaggacctgctgggcttcctgctggaggaaagc
ggagatttgggggtagtgcccaacgaggccatggaggctccagtgaactgggagttaccg
ctttcccaggcactgagcgattgggacatagaggatttcctgagctctctgcagagtccc
ccagcatcattgagtgttctcagcaactcgaacccctgtcttgtccaccatgatcacacc
tattctctcccacaggaacatgtttccataggtctagatagtgagagctgtggagaagag
ggggccctgattcctttgcatgtggaggagccgtcagagcaggagatggttaggctgata
ctgacagatgaggagaagaggctattggagcaggaggggattactctgcctgggactttt
cctctcactaagatggaggaacaagttctaaaacgagtgcggaggaagattcgaaataaa
aggtctgcccaagagagccgcaggaagaagaaggtgtatgtgggaagtttagaaagcagg
gtcttaaaatacacagcccagaatctggagctacagaacaaagtacagctcctagaggaa
cagaatctgtctcttctggatcagctgaggagactccaggccatggtggttcagatagca
aacaaaaccagcagcagcagcacctgtgtcttggtcctgctgttctccttctgtctcctc
cttgtacccgctatgtactcctctgacacaagggggcgtctgccagctgagcatggagtg
ttatcccgccagcttcgtggtctcagtgaagaccctcaccagctggagctgcctgccttg
cagccagaggtaccaaagaacaactcagaccgagagctccaggctcctgacaattcttgc
ctgctctaccacatgcctcaggctcctggcacagagcctcccatgaagttgccactcctt
gaccacttctcaaagtcccctcaccccgatcccattctttacctgcatgcaaatctcaca
agagagggagaatggctccctgctcacagctccgtatgtgttatcttacaaggcagacat
tcaggctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505169
Entry
107505169         CDS       T06036                                 

Gene name
CREB1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform X1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04380  Osteoclast differentiation
ray04612  Antigen processing and presentation
ray04668  TNF signaling pathway
ray04710  Circadian rhythm
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04911  Insulin secretion
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04931  Insulin resistance
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04962  Vasopressin-regulated water reabsorption
ray05016  Huntington disease
ray05020  Prion disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05203  Viral carcinogenesis
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107505169 (CREB1)
   04024 cAMP signaling pathway
    107505169 (CREB1)
   04022 cGMP-PKG signaling pathway
    107505169 (CREB1)
   04151 PI3K-Akt signaling pathway
    107505169 (CREB1)
   04152 AMPK signaling pathway
    107505169 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107505169 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    107505169 (CREB1)
   04922 Glucagon signaling pathway
    107505169 (CREB1)
   04915 Estrogen signaling pathway
    107505169 (CREB1)
   04926 Relaxin signaling pathway
    107505169 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    107505169 (CREB1)
   04918 Thyroid hormone synthesis
    107505169 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    107505169 (CREB1)
   04916 Melanogenesis
    107505169 (CREB1)
   04924 Renin secretion
    107505169 (CREB1)
   04925 Aldosterone synthesis and secretion
    107505169 (CREB1)
   04927 Cortisol synthesis and secretion
    107505169 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107505169 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107505169 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    107505169 (CREB1)
   04728 Dopaminergic synapse
    107505169 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107505169 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    107505169 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    107505169 (CREB1)
   04713 Circadian entrainment
    107505169 (CREB1)
   04714 Thermogenesis
    107505169 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107505169 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    107505169 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107505169 (CREB1)
   05020 Prion disease
    107505169 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    107505169 (CREB1)
   05031 Amphetamine addiction
    107505169 (CREB1)
   05034 Alcoholism
    107505169 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107505169 (CREB1)
   04934 Cushing syndrome
    107505169 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107505169 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107505169 (CREB1)
   05161 Hepatitis B
    107505169 (CREB1)
   05163 Human cytomegalovirus infection
    107505169 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107505169 (CREB1)
   05165 Human papillomavirus infection
    107505169 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107505169 (CREB1)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107505169 (CREB1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107505169 (CREB1)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    107505169 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf HNF-1A_C
Other DBs
NCBI-GeneID: 107505169
NCBI-ProteinID: XP_015990530
LinkDB
Position
Unknown
AA seq 341 aa
MTMESGAENQQSGDAAVTEPENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaacct
gaaaaccagcaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccaccgtaactttagtacagctgcccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccgcaagtccagacagttcagtcttcctgtaaggacttaaaaagacttttctccggaact
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tctcaaaaacgaagagaaattctttcaaggaggccttcctacaggaaaattttgaatgac
ttatcttctgatgcaccgggagtaccaaggattgaagaagagaagtctgaagaagagact
tcagcccctgccatcaccactgtaacggtgccaactccgatttaccaaactagcagtgga
cagtacattgccattacccagggaggagcaatacagctggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagccgccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacaaacataccagatccgcacagcaccaactagc
accatcgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcccgaaagagagaggttcgcctaatgaagaacagggaagcagcacgagagtgc
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgctggaaaac
caaaacaagacactgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505683
Entry
107505683         CDS       T06036                                 

Gene name
CREB5
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04668  TNF signaling pathway
ray04714  Thermogenesis
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04911  Insulin secretion
ray04915  Estrogen signaling pathway
ray04918  Thyroid hormone synthesis
ray04922  Glucagon signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04931  Insulin resistance
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04962  Vasopressin-regulated water reabsorption
ray05016  Huntington disease
ray05020  Prion disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05203  Viral carcinogenesis
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107505683 (CREB5)
   04024 cAMP signaling pathway
    107505683 (CREB5)
   04022 cGMP-PKG signaling pathway
    107505683 (CREB5)
   04151 PI3K-Akt signaling pathway
    107505683 (CREB5)
   04152 AMPK signaling pathway
    107505683 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107505683 (CREB5)
   04922 Glucagon signaling pathway
    107505683 (CREB5)
   04915 Estrogen signaling pathway
    107505683 (CREB5)
   04926 Relaxin signaling pathway
    107505683 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    107505683 (CREB5)
   04918 Thyroid hormone synthesis
    107505683 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    107505683 (CREB5)
   04925 Aldosterone synthesis and secretion
    107505683 (CREB5)
   04927 Cortisol synthesis and secretion
    107505683 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107505683 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107505683 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    107505683 (CREB5)
   04728 Dopaminergic synapse
    107505683 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    107505683 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    107505683 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107505683 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    107505683 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107505683 (CREB5)
   05020 Prion disease
    107505683 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    107505683 (CREB5)
   05031 Amphetamine addiction
    107505683 (CREB5)
   05034 Alcoholism
    107505683 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107505683 (CREB5)
   04934 Cushing syndrome
    107505683 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107505683 (CREB5)
   05161 Hepatitis B
    107505683 (CREB5)
   05163 Human cytomegalovirus infection
    107505683 (CREB5)
   05165 Human papillomavirus infection
    107505683 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107505683 (CREB5)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    107505683 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri NDUFB11
Other DBs
NCBI-GeneID: 107505683
NCBI-ProteinID: XP_015991442
LinkDB
Position
Unknown
AA seq 560 aa
MLAQGQELEWVACIFCCQSPQSRMCLIFIFPSLSDMCQGIRAGNRSITSFCRPIYEESKM
NLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNLLSDQTPTPTRFLKN
CEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNTVGGAMAGPGAHQLGSTRMPNHDTS
VVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTM
PGSSAVILPMERQMSVNSNLLGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMA
NGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPAHHPYPHQHQHPAHHPHPQPHHQ
QNHPHHHSHSHLHAHPAHHQTSPHPPLHSGNQAQVSPATQQMQPTQTIQPPQPTGGRRRR
VVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEV
AQLKQLLLTHKDCPITAMQKESQGYLSPESSPAASPVPACSQQQVIQHNTITTSSAVSEV
VGSSTLSQLTTHRTDLNPIL
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcttgcccaaggccaggaactggagtgggttgcgtgtatattttgttgtcagagtccg
cagagcagaatgtgtttgatttttatttttccctccctctctgacatgtgtcaaggaata
agggctggaaacaggtccattacgtcattctgcaggccaatttatgaggaatccaagatg
aatttggagcaggagaggccatttgtctgcagtgccccaggctgctcccagcgcttccca
acagaagaccatctgatgattcataggcacaagcatgaaatgactttgaagtttccctca
ataaaaacagacaatctgttatcagatcagactccgaccccaacaaggttcctgaagaac
tgtgaggaagtggggctcttcagcgagctggactgctccctggagcacgagttccggaag
gcccaggaggaggagagcagcaagcggaacatctcgatgcataacacagtgggtggggcc
atggcggggcccggagctcaccagcttggcagcacccggatgcccaaccatgacaccagc
gttgtgattcagcaagccatgccgtcaccccagtccagctccgtcatcacacaggcacct
tccaccaaccgccagatcgggcctgtcccaggctctctatcttctctgctacatctccac
aacagacagagacagcccatgccagcctccatgcccgggaccctgcccaaccctacaatg
ccaggatcttccgccgtgatcctacctatggagagacaaatgtcagtgaactccaacctc
ctgggaatgcaaggtccaaatctcagcaacccctgtgcttctccccaagtccagccaatg
cattcagaagccaaaatgaggctgaaggccgcattgactcaccatcctgctgccatggca
aatgggaacatgaacaccatgggacacatgatggaaatgatgggctcccggcaggaccag
acgccgcaccatcacatgcactctcacccgcatcagcaccagacactgccagcccatcac
ccctacccgcaccagcaccagcacccggcacaccatcctcatcctcaaccccatcaccag
cagaaccacccacaccaccactcccactcgcatctccatgcgcacccggcacatcaccag
acctcgccacacccccccctgcactccggcaaccaagcacaggtttcaccagccacgcaa
cagatgcagcccacccagacgatacagccgccccagcccacaggggggcgccggcgaagg
gtggtggacgaggatcctgacgagaggaggaggaaatttctggaacgcaaccgagcagcc
gccacccgctgcagacagaagaggaaggtctgggtgatgtcactggaaaagaaagctgaa
gaactcacccagacaaacatgcagcttcagaacgaagtgtccatgttgaagaacgaggtg
gcacagctgaagcagttgttgttgacacataaagactgcccgataacagccatgcagaag
gaatcgcaaggatatctaagtccagagagtagccctgcggcgagcccggtccccgcttgc
tctcagcagcaagtcatccagcataacaccatcactacttcctctgcagtcagcgaggtc
gtaggaagctccactctcagccagctcaccactcacagaacagacctgaatccaattctt
taa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509179
Entry
107509179         CDS       T06036                                 

Gene name
CREB3L4
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04668  TNF signaling pathway
ray04714  Thermogenesis
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04911  Insulin secretion
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04922  Glucagon signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04931  Insulin resistance
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04962  Vasopressin-regulated water reabsorption
ray05016  Huntington disease
ray05020  Prion disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05203  Viral carcinogenesis
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107509179 (CREB3L4)
   04024 cAMP signaling pathway
    107509179 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    107509179 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    107509179 (CREB3L4)
   04152 AMPK signaling pathway
    107509179 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107509179 (CREB3L4)
   04922 Glucagon signaling pathway
    107509179 (CREB3L4)
   04915 Estrogen signaling pathway
    107509179 (CREB3L4)
   04926 Relaxin signaling pathway
    107509179 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    107509179 (CREB3L4)
   04918 Thyroid hormone synthesis
    107509179 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    107509179 (CREB3L4)
   04916 Melanogenesis
    107509179 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    107509179 (CREB3L4)
   04927 Cortisol synthesis and secretion
    107509179 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107509179 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107509179 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    107509179 (CREB3L4)
   04728 Dopaminergic synapse
    107509179 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    107509179 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    107509179 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107509179 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    107509179 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107509179 (CREB3L4)
   05020 Prion disease
    107509179 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    107509179 (CREB3L4)
   05031 Amphetamine addiction
    107509179 (CREB3L4)
   05034 Alcoholism
    107509179 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107509179 (CREB3L4)
   04934 Cushing syndrome
    107509179 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107509179 (CREB3L4)
   05161 Hepatitis B
    107509179 (CREB3L4)
   05163 Human cytomegalovirus infection
    107509179 (CREB3L4)
   05165 Human papillomavirus infection
    107509179 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107509179 (CREB3L4)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107509179 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB EMP24_GP25L HAUS-augmin3 MscS_porin DUF4200 JMY MCU
Other DBs
NCBI-GeneID: 107509179
NCBI-ProteinID: XP_015996991
LinkDB
Position
Unknown
AA seq 395 aa
MDFRTPDLLDVWLEPPEDVFSTGSFLELGLHCPPPEVPVPRLQEQGLQGWEAPGGRGCGL
QESEPEDLPKLFIDPNEVYCSEASPGSDSGISEDPGRPDSPPAPKASSSPALYEVIYEAG
ALERMQGEAGPAVGLISIQLDQWSPPFMVPDACVVSELPLDARAHLLPPAGTVSPVPPSA
LLSCQALFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSVQNQELQKKVQELERHNISLVTQLRQLQMLMTQTSSKAAQTSTCVLI
LLFSLALIILPSLSPFQGLPEAGPEDYQPHGVISRNILTHKDMMENQETPVAESRLRVPP
GAKGANGSIRTLLEKMGGKTGPGGHVRMAVHADEM
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggatttcagaacccctgaccttctggatgtgtggctggagcccccagaggatgtcttc
tcaacaggatcctttctggagctgggactccactgtccacctccagaggtcccagtgccc
aggctgcaggaacaggggctgcaaggctgggaggcccctgggggccgtggctgcggcctt
caggagagcgagcccgaagatctcccgaagcttttcattgaccccaatgaagtgtactgc
tcagaagcatctcctggcagtgacagcggaatctccgaggacccgggtcgcccagacagt
ccacctgcccccaaggcatccagttcccctgccctctacgaggtcatctatgaggcaggg
gccctggagaggatgcagggggaagccgggccagccgtggggctcatctccatccagcta
gatcagtggagccccccatttatggtgcccgatgcctgtgtggtcagcgagctgcccctt
gacgcccgtgcccacctgctgcccccagccggcactgtaagcccagtgcctccttccgcc
ctgctgtcctgtcaagccttgttcctgacagatgaggagaagcgtcttttggggcaggaa
ggggtctccctgccctctcacctgccgctcaccaaggcagaggagagggtcctcaagaag
gtccggaggaaaatccggaacaagcagtcggcccaggacagtcggcggcggaagaaggag
tacatcgacggactggagagcagggtggctgcctgttccgtgcagaaccaggaactgcag
aagaaagtccaggagctggagaggcacaacatctccctggtgactcagctccgccagctg
cagatgctcatgactcagacttccagcaaagccgcccagaccagcacctgcgttctgatc
ctgcttttctccctggctctcatcatcctgcccagtctcagcccctttcaaggtctccca
gaagccgggccagaggattaccagcctcatggagtgatttccaggaatatcctgactcac
aaggacatgatggagaatcaggagaccccagtggcagagtccagattgagggtgccccct
ggggccaagggtgccaatggctcaataaggacactgctggagaagatgggagggaagaca
ggccccggtgggcacgtcagaatggctgtgcacgcagatgagatgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510647
Entry
107510647         CDS       T06036                                 

Gene name
CREB3L3
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 3 isoform X1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04668  TNF signaling pathway
ray04714  Thermogenesis
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04911  Insulin secretion
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04922  Glucagon signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04931  Insulin resistance
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04962  Vasopressin-regulated water reabsorption
ray05016  Huntington disease
ray05020  Prion disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05203  Viral carcinogenesis
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107510647 (CREB3L3)
   04024 cAMP signaling pathway
    107510647 (CREB3L3)
   04022 cGMP-PKG signaling pathway
    107510647 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    107510647 (CREB3L3)
   04152 AMPK signaling pathway
    107510647 (CREB3L3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107510647 (CREB3L3)
   04922 Glucagon signaling pathway
    107510647 (CREB3L3)
   04915 Estrogen signaling pathway
    107510647 (CREB3L3)
   04926 Relaxin signaling pathway
    107510647 (CREB3L3)
   04935 Growth hormone synthesis, secretion and action
    107510647 (CREB3L3)
   04918 Thyroid hormone synthesis
    107510647 (CREB3L3)
   04928 Parathyroid hormone synthesis, secretion and action
    107510647 (CREB3L3)
   04916 Melanogenesis
    107510647 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    107510647 (CREB3L3)
   04927 Cortisol synthesis and secretion
    107510647 (CREB3L3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107510647 (CREB3L3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107510647 (CREB3L3)
  09156 Nervous system
   04725 Cholinergic synapse
    107510647 (CREB3L3)
   04728 Dopaminergic synapse
    107510647 (CREB3L3)
  09149 Aging
   04211 Longevity regulating pathway
    107510647 (CREB3L3)
  09159 Environmental adaptation
   04714 Thermogenesis
    107510647 (CREB3L3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107510647 (CREB3L3)
  09162 Cancer: specific types
   05215 Prostate cancer
    107510647 (CREB3L3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107510647 (CREB3L3)
   05020 Prion disease
    107510647 (CREB3L3)
  09165 Substance dependence
   05030 Cocaine addiction
    107510647 (CREB3L3)
   05031 Amphetamine addiction
    107510647 (CREB3L3)
   05034 Alcoholism
    107510647 (CREB3L3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107510647 (CREB3L3)
   04934 Cushing syndrome
    107510647 (CREB3L3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107510647 (CREB3L3)
   05161 Hepatitis B
    107510647 (CREB3L3)
   05163 Human cytomegalovirus infection
    107510647 (CREB3L3)
   05165 Human papillomavirus infection
    107510647 (CREB3L3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107510647 (CREB3L3)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107510647 (CREB3L3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf KASH_CCD ZapB
Other DBs
NCBI-GeneID: 107510647
NCBI-ProteinID: XP_015999852
LinkDB
Position
Unknown
AA seq 448 aa
MAASACPVGPIDSLELLDLLFDKQDGILSHVDLGEAWSHVGDQQVLPGPDSDDFLSCILG
SGDSASSSPLWSPAASDSGISEDLPSDPQDTPPHSVPATALSSCHAPEPGKGPRPPYCPV
LPGPARPPGPAAQGLEDSVAIDLGMWSPGLEEQARPADLPPRGGLTVKDLLLSGSGGDLQ
QHHLAAPHLLQPGPGHCPQLVLTEDEKKLLAKEGVTLPTQLPLTKYEERVLKKIRRKIRN
KQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQS
TSKSAQAGTCIAVLLLSFALIVLPSISPFASNKAESPGDFTPVRVFSRTLHNDAASRVAP
GTHPGSEDPGPQPEAGAPQGGSPGSPKVDWDSRDMLALDTSTAEQDNSTLGPGNLTEELS
RASLLDWASPKPALSPGRVGLEAAGAEL
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggctgcctccgcctgccccgtgggccccatcgacagcctggagctgctggacctcctg
ttcgacaagcaagatggaatcctgagccacgtggacctgggagaggcatggagccacgta
ggggaccagcaggtcctgccgggcccggattccgatgatttcctcagctgtatcttgggt
tccggagactcagcctccagctctccactctggtctcctgcggccagtgacagtggcatc
tccgaagatctgccctccgacccccaggacacccctccacacagtgtgccagccactgct
ctgtccagctgccatgccccagagcctggcaaggggccccgccccccctactgtcctgtg
ctccccggccccgccaggccccccgggccggcggcccagggccttgaggactctgtagcc
atagacctaggaatgtggagcccaggcctcgaggagcaggccaggccggcggacctgccc
ccgcgaggcggcctcaccgtgaaagacctcctcctctccggcagtggcggggacctgcaa
cagcatcacctggcggccccccacctgttgcagcctgggcccgggcactgcccgcagctg
gtgctcacggaagacgagaagaagctgctggccaaagaaggcgtcaccctgcccacccag
cttcccctcaccaagtacgaggagcgagtactgaaaaaaatccgccggaaaatccggaac
aagcagtcagcacaagaaagccggaaaaagaagaaggaatacatcgacggcttggaaact
cggatgtcagcctgcactgcccagaaccaggagctccagaggaaagtcttgcatcttgag
aagcagaacctgtccctcttggagcagctgaagaaactccaggccattgtcgtccagtcc
accagcaagtcggcccaggccggcacctgcatagcggtcctgctgctctctttcgccctc
atcgtcctcccctccatcagcccgttcgcctccaacaaagccgagagccccggcgacttc
acacctgtgcgagttttctctagaaccctgcacaatgacgctgcttcccgcgtggccccc
ggcactcatccaggttctgaggacccaggaccccagcctgaggctggcgcaccccaggga
gggtctccaggaagccccaaggtggactgggactcccgggacatgctggctctggacacc
tcgacggcggagcaggacaactccaccctgggcccgggaaacttgacagaggagctgagc
cgggccagcctgctggactgggcatcgccgaagcccgcgctcagccccgggcgcgtgggg
ctggaggcggcgggggcggagctgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511864
Entry
107511864         CDS       T06036                                 

Gene name
CREB3L1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 3-like protein 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04668  TNF signaling pathway
ray04714  Thermogenesis
ray04725  Cholinergic synapse
ray04728  Dopaminergic synapse
ray04911  Insulin secretion
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04922  Glucagon signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04931  Insulin resistance
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04962  Vasopressin-regulated water reabsorption
ray05016  Huntington disease
ray05020  Prion disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05034  Alcoholism
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05203  Viral carcinogenesis
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107511864 (CREB3L1)
   04024 cAMP signaling pathway
    107511864 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    107511864 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    107511864 (CREB3L1)
   04152 AMPK signaling pathway
    107511864 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107511864 (CREB3L1)
   04922 Glucagon signaling pathway
    107511864 (CREB3L1)
   04915 Estrogen signaling pathway
    107511864 (CREB3L1)
   04926 Relaxin signaling pathway
    107511864 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    107511864 (CREB3L1)
   04918 Thyroid hormone synthesis
    107511864 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    107511864 (CREB3L1)
   04916 Melanogenesis
    107511864 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    107511864 (CREB3L1)
   04927 Cortisol synthesis and secretion
    107511864 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107511864 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107511864 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    107511864 (CREB3L1)
   04728 Dopaminergic synapse
    107511864 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    107511864 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107511864 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107511864 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    107511864 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107511864 (CREB3L1)
   05020 Prion disease
    107511864 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    107511864 (CREB3L1)
   05031 Amphetamine addiction
    107511864 (CREB3L1)
   05034 Alcoholism
    107511864 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107511864 (CREB3L1)
   04934 Cushing syndrome
    107511864 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107511864 (CREB3L1)
   05161 Hepatitis B
    107511864 (CREB3L1)
   05163 Human cytomegalovirus infection
    107511864 (CREB3L1)
   05165 Human papillomavirus infection
    107511864 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107511864 (CREB3L1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    107511864 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 ELP6 Jnk-SapK_ap_N TPR_MLP1_2 Prominin APG6_N HAUS-augmin3 JMY RNase_Y_N DUF4404 ADIP DUF724
Other DBs
NCBI-GeneID: 107511864
NCBI-ProteinID: XP_016002239
LinkDB
Position
Unknown
AA seq 520 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDEKSPLLDMELDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDMEHGAWVLG
HKLCSVMVKQEQSPDLPVDPLAASSAMAAAAAAMASTPLLGLSPLSRLPVPHQAPGEMTQ
LPVIKAEPQEMNQFLKVTPEDLVQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSST
AISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPIPTKLPLTKAEEKALKRVRRKIK
NKISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTN
KISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPMATDSIYTASQ
MPSRNLLFYDEGPGSWEDGRSTLMPVEPPDGWEIKPGGPVEQRPQDHLQHDHLDSTHETT
KYLSEAWPKDVGNGTSPNFSHPKEWFHERDLGPNTTIKLS
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggacgccgtcttagaacccttcccggccgacaggctgttccccggatccagcttcctg
gacttgggggatctgaacgagtcggatttcctcaacaatgcgcacttccctgagcacctg
gaccacttcgcggagaacatggaagacttctccaacgacctgttcagcagtttctttgat
gaccctgtgctggatgagaagagccctctactggacatggaactggactcccctacacca
ggcatccaggctgagcacagctactccctgagcggtgactcggcgcctcagagtcccctt
gtgcccatcaagatggaggacaccacccaagacatggaacatggagcctgggtgctggga
cacaagctgtgctccgtcatggtgaagcaggagcagagcccagatctgcccgtggaccct
ctggccgcctcctccgccatggctgccgccgctgccgccatggccagcaccccgctgctg
ggcctcagccccctgtccaggctgcccgtcccccaccaggccccaggagagatgactcag
ctgccagtgatcaaagcagagccccaggagatgaatcagtttctcaaagtgacaccagag
gacctggtgcagatgcctccgacgcccccgagcagccatggcagtgacagtgatggctcc
cagagtccccgatctctgcccccctccagccctgtccggcccatggcccgttcctccact
gccatctccacctcccccctcctcaccgcccctcacaaattacaagggacatcaggacca
ctgcttctgacggaggaggagaagcgcaccctgatcgctgagggctaccctatccccacg
aaactccccctcaccaaagctgaggagaaggccttgaagagggtccggagaaaaatcaag
aacaagatctcagcccaggagagccgccgtaagaagaaggaatacgtggagtgtctagaa
aagaaagtagagacatttacatcggagaacaacgaactgtggaagaaggtggagaccctg
gagaatgccaacaggaccctgctccagcagctgcagaaactccagactctggtcaccaac
aagatctccagaccttacaagatggctgccacccagactgggacctgcctcatggtggca
gccttgtgttttgttctggtgctgggctcccttgtgccctgcctccctgagttctcctcc
ggctcccagactgtgaaggaagaccccatggccactgacagcatctacacagccagtcag
atgccctcccgaaacctcctgttctacgatgaggggccagggtcctgggaggatggccgc
agcaccctaatgcctgtggagcccccagatggctgggaaatcaagcccggagggccagtg
gagcagcgaccccaggaccacctgcaacatgaccacctggacagcacccatgagaccacc
aagtacctgagtgaagcctggccaaaagatgtcggaaatggcaccagccccaacttctcc
caccccaaggagtggttccatgagagggatctgggcccaaacaccaccatcaagctctca
tag

DBGET integrated database retrieval system