KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499062
Entry
107499062         CDS       T06036                                 

Gene name
CHRM2
Definition
(RefSeq) muscarinic acetylcholine receptor M2
  KO
K04130  muscarinic acetylcholine receptor M2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04725  Cholinergic synapse
ray04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107499062 (CHRM2)
   04024 cAMP signaling pathway
    107499062 (CHRM2)
   04151 PI3K-Akt signaling pathway
    107499062 (CHRM2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107499062 (CHRM2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107499062 (CHRM2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107499062 (CHRM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107499062 (CHRM2)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    107499062 (CHRM2)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 107499062
NCBI-ProteinID: XP_015978367
LinkDB
Position
Unknown
AA seq 486 aa
MNLPSLNVCLATGLLIREHKMNNSTNSSNSGLALTSPYKTFEVVFIVLVAGSLSLVTIIG
NILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWL
ALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAIL
FWQFIVGVRTVKDGECYIQFFSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKD
KKEPVANQDPVSPSLVQGRIVKPNNDNTPGSDDGLEHNRIQNGKAPRDAVTENCVQGEEK
ESSNDSTSVSAVASNLRDDEITQDENTISTSLGHSKDENSKQTCIKIVTKTQKGDSCTTT
NTTVELVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITW
APYNVMVLINTFCAPCIPNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYK
NIGATR
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaacttgccaagtttaaatgtttgtttggctactggactcctgattagagaacacaaa
atgaataactcaaccaactcttctaacagtggcctggctttgaccagcccttataagaca
ttcgaagtggtgtttattgtccttgtggctggatcgctcagtttggtgaccattattggg
aacatcctggtcatggtctccattaaagtcaaccgccacctccagaccgtcaacaattac
tttttgttcagcttggcctgtgctgacctcatcattggcgttttctccatgaacttgtac
accctctacactgtgattggctactggcctttgggccctgtggtgtgtgacctttggtta
gccctggactatgtggtcagcaacgcctcggtgatgaatctgctcattatcagctttgac
aggtacttctgtgtcacgaaaccgctcacctaccctgtcaagcggaccacgaaaatggca
gggatgatgatcgcagccgcctgggtcctctccttcatcctctgggccccggccatcctc
ttctggcagttcatcgtaggggtgaggactgtgaaggatggggaatgctacattcagttt
ttctccaacgcggctgtcaccttcgggaccgccatcgcggccttctatttgccagtgatc
atcatgaccgtgttatactggcacatatcccgggccagcaagagcaggataaagaaggac
aagaaggagcccgtggccaaccaagacccggtttctccaagtctggttcagggaaggatc
gtgaagccaaacaatgacaacacgcccggcagtgatgatggcctggagcacaacagaatc
cagaacggcaaagcccccagagacgctgtgactgaaaactgtgtccagggggaggagaaa
gagagctccaacgattccacctcagtcagtgccgtcgcctctaatctgagagatgatgaa
ataacccaggatgaaaacacaatttccacttccctgggccattccaaagatgagaactct
aagcaaacgtgcatcaaaattgtcaccaagacccaaaagggtgattcgtgtaccacgact
aataccactgtggagctggttggctcttcaggtcagaacggagatgaaaaacagaacatt
gtggctcgcaagatcgtgaagatgacgaagcagcccgcaaaaaagaagcctcctccatct
cgggaaaagaaagtgaccaggacgatcctggctattctgctggccttcatcatcacgtgg
gccccgtacaatgtcatggtgctgatcaataccttctgtgcgccctgcatccccaacacg
gtgtggaccattgggtactggctctgttacatcaacagcaccatcaaccctgcctgctac
gcactttgcaacgccaccttcaagaagacctttaaacaccttctcatgtgtcattataag
aacataggcgctacgaggtaa

DBGET integrated database retrieval system