KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499083
Entry
107499083         CDS       T06036                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04064  NF-kappa B signaling pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04115  p53 signaling pathway
ray04210  Apoptosis
ray04218  Cellular senescence
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107499083 (GADD45G)
   04064 NF-kappa B signaling pathway
    107499083 (GADD45G)
   04068 FoxO signaling pathway
    107499083 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107499083 (GADD45G)
   04210 Apoptosis
    107499083 (GADD45G)
   04115 p53 signaling pathway
    107499083 (GADD45G)
   04218 Cellular senescence
    107499083 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107499083 (GADD45G)
   05202 Transcriptional misregulation in cancer
    107499083 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107499083 (GADD45G)
   05212 Pancreatic cancer
    107499083 (GADD45G)
   05225 Hepatocellular carcinoma
    107499083 (GADD45G)
   05226 Gastric cancer
    107499083 (GADD45G)
   05214 Glioma
    107499083 (GADD45G)
   05216 Thyroid cancer
    107499083 (GADD45G)
   05220 Chronic myeloid leukemia
    107499083 (GADD45G)
   05217 Basal cell carcinoma
    107499083 (GADD45G)
   05218 Melanoma
    107499083 (GADD45G)
   05213 Endometrial cancer
    107499083 (GADD45G)
   05224 Breast cancer
    107499083 (GADD45G)
   05222 Small cell lung cancer
    107499083 (GADD45G)
   05223 Non-small cell lung cancer
    107499083 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    107499083 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107499083 (GADD45G)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107499083 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107499083 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 107499083
NCBI-ProteinID: XP_015978403
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEVRCQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNIDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGDEAGAPGDLHCI
LISNPNEDSWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgctgccaggacacggttcctgaaagcacagccaggatgcag
ggagccgggaaagcgctgcacgagctgttgctgtcggcgcagcgccagggctgcctcact
gctggcgtctacgagtccgccaaagtcctgaacattgaccctgacaacgtgaccttttgc
gtgctggccgccgatgaggaggacgagggcgacatcgcgctgcagatccacttcacgctg
attcaggcgttctgctgcgagaacgacatcgacatcgtgcgagtgggcgacgtgcagcgg
ctggcggccatcgtgggcgccggtgacgaggcgggtgctccgggagacctgcactgtatc
cttatttcgaaccccaatgaggactcgtggaaggaccccgccttggagaagctcagcctg
ttttgcgaggaaagccgcagtgtcaacgactgggtgcccagtatcaccctacccgagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520147
Entry
107520147         CDS       T06036                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04064  NF-kappa B signaling pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04115  p53 signaling pathway
ray04210  Apoptosis
ray04218  Cellular senescence
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107520147 (GADD45B)
   04064 NF-kappa B signaling pathway
    107520147 (GADD45B)
   04068 FoxO signaling pathway
    107520147 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107520147 (GADD45B)
   04210 Apoptosis
    107520147 (GADD45B)
   04115 p53 signaling pathway
    107520147 (GADD45B)
   04218 Cellular senescence
    107520147 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107520147 (GADD45B)
   05202 Transcriptional misregulation in cancer
    107520147 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107520147 (GADD45B)
   05212 Pancreatic cancer
    107520147 (GADD45B)
   05225 Hepatocellular carcinoma
    107520147 (GADD45B)
   05226 Gastric cancer
    107520147 (GADD45B)
   05214 Glioma
    107520147 (GADD45B)
   05216 Thyroid cancer
    107520147 (GADD45B)
   05220 Chronic myeloid leukemia
    107520147 (GADD45B)
   05217 Basal cell carcinoma
    107520147 (GADD45B)
   05218 Melanoma
    107520147 (GADD45B)
   05213 Endometrial cancer
    107520147 (GADD45B)
   05224 Breast cancer
    107520147 (GADD45B)
   05222 Small cell lung cancer
    107520147 (GADD45B)
   05223 Non-small cell lung cancer
    107520147 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    107520147 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107520147 (GADD45B)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107520147 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107520147 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 107520147
NCBI-ProteinID: XP_016019054
LinkDB
Position
Unknown
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEGDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPDEAQGTAEARDLHCL
LVTNPHTDAWKSQGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaccctggaagagctggtggcgtgcgacaacgcggcgcagaagatgcagaccgtgagc
gccgcggtggaggagctgctggtggccgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggaccctgacagcgtggtcctgtgcctcttggcc
atcgacgaggaggaggagggcgacatcgccctgcagatccacttcacgctcatccagtcc
ttttgctgcgacaacgacatcgacatcgtccgggtgtccggcatgcagcgcctggcacag
ctgctgggcgagccagacgaggcccagggcaccgccgaggcccgggacctgcactgcctc
ctggtcacgaacccgcacaccgacgcctggaagagccagggcctggtggaggtggccagt
tactgcgaggagagccgggggaacaaccagtgggtgccctacatctccctccaggagcgc
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520573
Entry
107520573         CDS       T06036                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04064  NF-kappa B signaling pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04115  p53 signaling pathway
ray04210  Apoptosis
ray04218  Cellular senescence
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05216  Thyroid cancer
ray05217  Basal cell carcinoma
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107520573 (GADD45A)
   04064 NF-kappa B signaling pathway
    107520573 (GADD45A)
   04068 FoxO signaling pathway
    107520573 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107520573 (GADD45A)
   04210 Apoptosis
    107520573 (GADD45A)
   04115 p53 signaling pathway
    107520573 (GADD45A)
   04218 Cellular senescence
    107520573 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107520573 (GADD45A)
   05202 Transcriptional misregulation in cancer
    107520573 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107520573 (GADD45A)
   05212 Pancreatic cancer
    107520573 (GADD45A)
   05225 Hepatocellular carcinoma
    107520573 (GADD45A)
   05226 Gastric cancer
    107520573 (GADD45A)
   05214 Glioma
    107520573 (GADD45A)
   05216 Thyroid cancer
    107520573 (GADD45A)
   05220 Chronic myeloid leukemia
    107520573 (GADD45A)
   05217 Basal cell carcinoma
    107520573 (GADD45A)
   05218 Melanoma
    107520573 (GADD45A)
   05213 Endometrial cancer
    107520573 (GADD45A)
   05224 Breast cancer
    107520573 (GADD45A)
   05222 Small cell lung cancer
    107520573 (GADD45A)
   05223 Non-small cell lung cancer
    107520573 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    107520573 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107520573 (GADD45A)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107520573 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107520573 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 107520573
NCBI-ProteinID: XP_016020027
LinkDB
Position
Unknown
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDANPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcaaaagaccgaaaggatggacaaggtgggg
gatgccctcgaggaagtgctaagcaaagccctgagtcagcgcaccatcacggtcggggtg
tatgaggcggccaagctgctcaacgttgacccggataacgtagtgctgtgcctgctggcc
gcggacgaggacgacgacagggatgtggctctgcagatccacttcaccctgatccaggcg
ttctgctgtgaaaacgacatcaacatcctgcgcgtcagcaacccgggccggctggcggag
ctcctgctcctagagaccgacgcgaacccggcggcgagcgagggggcagagcagcctcca
gacctacactgcgtgttggtgacgaatccacattcatcacaatggaaggatcccgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccctgaacggtga

DBGET integrated database retrieval system