KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499151
Entry
107499151         CDS       T06036                                 

Gene name
LPO
Definition
(RefSeq) lactoperoxidase
  KO
K12550  lactoperoxidase [EC:1.11.1.7]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107499151 (LPO)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     107499151 (LPO)
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 107499151
NCBI-ProteinID: XP_015978544
LinkDB
Position
Unknown
AA seq 726 aa
MRMLLRLPALLAFLTFLHAAASATHAQANKITAFVDTVSQVKAQINKAFLDSRTRLKTAL
SSEAPSPRHLSEYFKHAKGRTRTAIRNGQVWEESLKRLKQKGTLTNVTDPSLDLTALSRE
VGCDGYVPVLKCDNNSPYRTITGDCNNRKNPALGAANRALARWLPAEYEDELSLPFGWTA
GKTRNGFPTPLAREVSNQIASYLNEKDVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSE
YSKELCDKHCIQEDNCFPIMLPPRDPKLKTQGKCMPFFRAGFVCPTLPGHSLAREQINAL
TSFLDASFVYGSDPDLASRLRNLSSPLGLLAINQEYRDHGLAYLVFDNKKPSPCEFINTT
ARVPCFLAGDSRASEQILMTTSHTLFLREHNRLAGELKRLNPQWDGEKIYQEARKILGAF
VQIITFRDYLPIVLGVKMQKWVPPYQGYNESVDPRISNVFTFAFRFGHLEVPSTISRLDE
NYQPWGPEPELPLHTLFFNSWRIVKDGGIDPLVRGLLAKKSKLMNQNKMMTGELRNKLFQ
PTHKIHGFDLAAINIQRGRDHGMPGYNSWRRFCDLSQPQTLAELGAVLKNKMLAKKLLNL
YGTPDNIDIWIGGTVEPLVEGGRVGSLLACIMGKQFQQIRDGDRFWWENPGVFTEKQRDS
LQKISFSRLVCDNTHITKVPLNPFQANSYPQGFVDCSAIDKLDLSPWASVENEVPPTLCN
KAHFGP
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgcggatgcttctccgtctcccagccctcctggctttcctgaccttcctccatgctgca
gcatctgccacacatgcacaagccaacaagatcactgccttcgttgatactgtgagtcag
gttaaggcccaaatcaacaaggccttcctggattcccggaccaggctgaagaccgccttg
agctctgaggcacctagcccccgacacttgtcagagtacttcaagcatgccaaaggccgg
actcgcacagccatccgcaatgggcaggtgtgggaggagtccttaaagaggctgaagcaa
aaagggaccctgaccaatgtcacagaccccagcctggacttgactgcactctctagggag
gtgggctgtgatggctatgttcctgtattgaagtgtgacaataacagcccgtaccgcacc
attacaggagactgtaacaacaggaagaaccccgcgctgggcgccgccaacagagcgctg
gcgcgctggctgccagcagagtacgaggatgagctctccctgcccttcgggtggacagcg
gggaagacgcggaacggcttcccaaccccgctggcccgtgaggtatccaaccagattgca
agttacctgaatgagaaggatgttctggaccaaaataggtccctgcttttcatgcagtgg
ggtcaaattgtggaccatgacctggactttgcccccgacactgagctcgggagcagtgag
tactccaaagagctgtgtgacaagcactgtatccaggaagataactgcttccccattatg
ctcccacccagggaccccaagttgaagactcaagggaagtgcatgcctttcttccgagcc
gggtttgtctgtcccactctacctggccattctctggcccgagagcagatcaacgctcta
acctccttcctggatgccagctttgtgtatggctctgaccccgacctagctagccgcctc
cgcaacctcagcagccctctgggcctcctggccatcaaccaggagtacagagaccatggg
ctggcctacctggtctttgacaacaagaagccgagcccctgtgagttcatcaacaccact
gcccgtgtaccctgcttcctggcaggagattcccgagcctcggagcagatcctgatgacc
acttcccacaccctctttctccgtgagcacaaccggctggccggagaactgaagagactc
aaccctcagtgggatggagagaaaatctaccaggaagcccggaaaatcctgggagccttc
gtgcagattatcacctttagggactacctacccatcgtgttaggtgtcaagatgcagaag
tgggtccctccataccaaggctacaacgagtctgtggacccacgaatttccaatgtcttc
acctttgccttccgctttggccacttggaggtcccctctactatatcccgcctggatgag
aactatcagccatggggtccagaaccagagctccctctgcacaccctcttcttcaacagc
tggaggattgtcaaagatggtggaattgaccctctggtgcggggcctactggccaagaag
tcaaagttgatgaatcagaataaaatgatgacaggagagctgcgcaataagcttttccag
cccactcacaagatccatggctttgacctggctgccatcaacatacagcgtggccgagac
catgggatgcctgggtacaactcctggagacgcttctgtgacctgtcacagccccagaca
ctggcagagctgggtgctgtgctgaagaacaagatgctagctaagaagttactgaatctc
tacgggacccctgacaacattgacatctggatcgggggcactgttgagccactggtagaa
gggggccgggtggggtctctcctggcctgcatcatgggcaagcagttccagcagattcgt
gatggggacaggttctggtgggagaaccctggagtcttcactgagaagcagcgggattct
ctacagaaaatatccttctcacgccttgtctgtgacaacacccacatcaccaaagtcccc
ctgaatccattccaagccaacagctacccccaaggctttgtggattgctcagccattgat
aagctagacctctcaccctgggcctcagtggagaatgaggtgccgcccacactgtgcaat
aaagcacactttggtccatga

DBGET integrated database retrieval system