KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499269
Entry
107499269         CDS       T06036                                 

Gene name
SLC5A7
Definition
(RefSeq) high affinity choline transporter 1
  KO
K14387  solute carrier family 5 (high affinity choline transporter), member 7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04725  Cholinergic synapse
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107499269 (SLC5A7)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107499269 (SLC5A7)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC5: Sodium glucose cotransporter
   107499269 (SLC5A7)
SSDB
Motif
Pfam: SSF
Other DBs
NCBI-GeneID: 107499269
NCBI-ProteinID: XP_015978779
LinkDB
Position
Unknown
AA seq 579 aa
MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSTEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPDYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDIDVHASVIVSALIAILYTLVGG
LYSVAYTDVVQLFCIFIGLWISVPFALSHPAVTDIGFTAVHAKYQEPWLGTIESYEVYTW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMALPAILIGAIGASTDW
NQTAYGLPDPKSNEKADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIIIFPQ
LLCVLFIKGTNTYGAVAGYVFGLFLRITGGEPYLYLQPLIFYPGYYSDKNGIYNQRFPFK
TLAMIASFLSNIGISYLAKYLFESGTLPPKLDVFDAVIARHSEENMDKTILVRNENIKLD
ELAPVKPRQSVTLSSTFTNKEAFLDVDSSPEGSGTEDNL
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggcttttcatgtggaaggactgatagctattatcgtgttctaccttctaatattgctg
gttggaatatgggctgcctggagaaccaaaaatagtggcagcacagaagagcgcagtgag
gccataatagttggtggccgagacattggtctgctggtgggtggatttaccatgacagcc
acttgggttggaggaggttacatcaatgggacagctgaagcagtatatgtaccagattat
ggtctagcttgggcacaagcaccgattggatattctcttagtctgattttaggtggtctg
ttctttgcaaaacctatgcgttccaagggctatgtgaccatgttagacccattccagcag
atctatgggaaacgcatgggcgggctcctatttattcctgcactcatgggagagatgttc
tgggctgcagctattttctctgccttaggagccaccatcagcgtgattattgacattgat
gttcatgcttctgtcattgtctctgcgctcattgccattctgtacaccctggtgggcggt
ctctactctgtggcctacacagatgtagttcagctcttttgcattttcataggactgtgg
atcagcgtcccttttgctctgtcgcatcctgcagttacggacattgggtttactgctgtg
catgccaaataccaggagccttggctggggaccattgaatcatatgaagtctacacttgg
cttgatagttttctgttgttgatgctgggtggaatcccatggcaagcctacttccagagg
gtcctctcttcatcctcagccacttatgctcaagtgctatccttcctggcagcttttgga
tgccttgtgatggctctaccagccatactcattggggccattggagcatcaacagactgg
aaccagactgcatatgggctaccagatcccaagagtaatgaaaaagcagacatgatttta
ccaattgttctgcaatatctctgccctgtgtacatttctttctttggtcttggtgcagtt
tctgctgctgttatgtcatcagcagattcttctatcttgtcagcaagttctatgtttgct
cggaacatataccagctttcattcagacaaaatgcatcagacaaggaaatcgtttgggtc
atgcgaatcacagtgtttgtgtttggagcttctgcaacagctatggccttgctaacaaag
accgtgtatgggctctggtacctcagctcagacctcgtttacatcatcatctttccgcag
ctgctttgtgtgctcttcatcaagggaaccaatacatatggagctgtggcaggttatgtt
tttggtcttttcctgagaataactggaggggagccatatctgtaccttcagcccttgatc
ttttatcctggttattactctgataagaatggtatatataatcagagattcccatttaaa
acactcgccatgattgcctcatttttatccaacattggcatctcttatctagccaaatat
ctatttgaaagtggaaccttgccaccaaaattagatgtatttgatgctgttattgcaagg
cacagtgaagaaaacatggataagacaattctagtcagaaatgaaaatattaaattagat
gaactcgcacccgtgaagcctcgacagagcgtaactctcagctcaactttcaccaataaa
gaggccttcctcgacgttgactccagtccagaagggtctggaactgaagataatttataa

DBGET integrated database retrieval system