KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499288
Entry
107499288         CDS       T06036                                 

Gene name
KCNJ6
Definition
(RefSeq) G protein-activated inward rectifier potassium channel 2 isoform X1
  KO
K05000  potassium inwardly-rectifying channel subfamily J member 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04713  Circadian entrainment
ray04723  Retrograde endocannabinoid signaling
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04915  Estrogen signaling pathway
ray04921  Oxytocin signaling pathway
ray04929  GnRH secretion
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107499288 (KCNJ6)
   04915 Estrogen signaling pathway
    107499288 (KCNJ6)
   04921 Oxytocin signaling pathway
    107499288 (KCNJ6)
  09156 Nervous system
   04727 GABAergic synapse
    107499288 (KCNJ6)
   04725 Cholinergic synapse
    107499288 (KCNJ6)
   04728 Dopaminergic synapse
    107499288 (KCNJ6)
   04726 Serotonergic synapse
    107499288 (KCNJ6)
   04723 Retrograde endocannabinoid signaling
    107499288 (KCNJ6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107499288 (KCNJ6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107499288 (KCNJ6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107499288 (KCNJ6)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107499288 (KCNJ6)
SSDB
Motif
Pfam: IRK_C IRK
Other DBs
NCBI-GeneID: 107499288
NCBI-ProteinID: XP_015978826
LinkDB
Position
Unknown
AA seq 423 aa
MAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKD
GKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGD
MDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSI
VNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAK
LIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKE
ELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYET
STPALSAKELAELAGRAELPLSWSVSSKLNQHAELETAEDEKNPEEQTERNGDVANLENE
SKV
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggccaagttgacagaatccatgactaacgtcctggagggcgactccatggatcaggac
gtcgagagcccggtggccattcaccagccgaagttgcctaagcaggccagggacgacctg
ccacgccacatcagccgagaccggaccaagaggaagatccagaggtacgtgcggaaagac
gggaagtgcaacgtgcaccacggcaacgtgagagagacttaccgctacctgaccgacatc
ttcaccaccttggtggacctcaagtggaggttcaacctgctgattttcgtcatggtttac
acggtgacgtggctctttttcgggatgatctggtggctgatcgcatatatccgaggagat
atggaccacatagaggacccctcgtggactccctgcgtcaccaacctcaatgggttcgtc
tccgcctttttattctcgatagagacggagaccactatcggttatggctaccgggtcatc
acggacaagtgcccggagggaattatcctcctcttaatccaatccgtgttggggtccatc
gtcaatgcgttcatggtgggatgcatgtttgtaaaaatctcacaacccaagaagagggca
gagaccctggttttttccacccacgcggtgatctccatgcgggacgggaagctgtgccta
atgttccgagtgggggacctcagaaattcccacatcgtggaggcttccattcgagccaag
ctgatcaaatccaaacagacctcggagggcgagttcatccctctgaaccagacggatatc
aacgtagggtattacaccggcgacgaccgtctgttcctggtgtccccgctcatcatcagc
cacgagatcaaccaacagagccccttctgggagatctccaaagcccagctgcccaaggag
gaactggaaattgtagtcatcttagaagggatggtggaagcgacaggcatgacgtgccag
gcccgaagctcctacatcaccagtgagatcctgtgggggtaccgcttcacccccgtgctc
accctggaggacgggttctacgaggtcgactacaacagcttccacgagacctacgagacc
agcactccggctctgagcgccaaagagctggccgagctggcgggcagggcggagctgccc
ctgagctggtcggtgtccagcaaactcaaccaacacgcagaactggagaccgcggaggac
gagaagaacccggaggagcagacggaaaggaatggtgatgtggcaaacctagagaacgag
tcgaaagtctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507814
Entry
107507814         CDS       T06036                                 

Gene name
KCNJ5
Definition
(RefSeq) G protein-activated inward rectifier potassium channel 4 isoform X1
  KO
K04999  potassium inwardly-rectifying channel subfamily J member 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04713  Circadian entrainment
ray04723  Retrograde endocannabinoid signaling
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04915  Estrogen signaling pathway
ray04921  Oxytocin signaling pathway
ray04925  Aldosterone synthesis and secretion
ray04929  GnRH secretion
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107507814 (KCNJ5)
   04915 Estrogen signaling pathway
    107507814 (KCNJ5)
   04921 Oxytocin signaling pathway
    107507814 (KCNJ5)
   04925 Aldosterone synthesis and secretion
    107507814 (KCNJ5)
  09156 Nervous system
   04728 Dopaminergic synapse
    107507814 (KCNJ5)
   04726 Serotonergic synapse
    107507814 (KCNJ5)
   04723 Retrograde endocannabinoid signaling
    107507814 (KCNJ5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107507814 (KCNJ5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107507814 (KCNJ5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107507814 (KCNJ5)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107507814 (KCNJ5)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 107507814
NCBI-ProteinID: XP_015994637
LinkDB
Position
Unknown
AA seq 424 aa
MRIPAMAGDSRNAMHQDMEIGVTPRDPKKIPKQARDYIPIATDRTRLLAEGKKPRQRYME
KSGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIR
GDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIILLLVQAILG
SIVNAFMVGCMFVKISQPKKRAETLMFSNNAVISMRDEKLCLMFRVGDLRNSHIVEASIR
AKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLTISHEINEKSPFWEMSRAQLD
QEEFEIVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTY
ETNTPSCCAKELAEMKREGRLFQYLPSTPLPGSCAKAEPDAEAEQNGKDEPERLSGSRKT
RDSV
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcgaatcccagctatggctggcgattctaggaatgctatgcaccaagatatggagatt
ggagtcactcccagggaccctaagaagattcccaaacaggctcgcgattacatccccatc
gccacagaccgcacccgcctgctggcggaaggcaagaagccccgccagcgctacatggag
aagagcggcaagtgcaacgtccaccacggcaacgtccaggagacctaccggtacctgagc
gacctcttcaccacgctggtggacctcaagtggcgcttcaacctgcttgtcttcaccatg
gtctacaccgtcacttggctgttcttcggtttcatttggtggctcattgcttatattcgg
ggtgatctggaccatgtcggtgaccaagagtggattccctgtgtcgaaaacctcagtggc
ttcgtgtccgccttcctgttctccattgagaccgaaaccaccatcgggtacggctttcgg
gtgatcacagagaagtgtccagaggggatcatactcctcttggtccaggccatccttggc
tccatcgtcaatgccttcatggtgggctgcatgtttgtcaagatcagccagccgaagaag
agagcggagaccctcatgttttccaacaacgcggtcatctccatgcgggatgagaagctc
tgcctcatgttccgggtgggtgaccttcgcaactcccacatcgtagaggcctccatccgc
gccaagctcatcaagtcccgacagaccaaagaaggggaattcatccctctgaaccaaacg
gacattaacgtgggttttgacacgggggatgaccgtctcttcctggtgtcgccgcttacc
atctcccatgagatcaatgagaagagccctttctgggagatgtccagggcccagctggat
caggaggagtttgaaatcgtggtcattctcgaagggatggtggaggcaacaggcatgact
tgccaagcacggagctcatacatggatacagaggtgctctggggccaccggttcacacca
gtcctcaccttggaaaaaggcttctatgaggtggactacaataccttccatgacacctac
gagaccaacacacccagctgctgtgccaaggagctggcggaaatgaagcgggaaggccgg
ctcttccagtaccttcccagcaccccgctgccgggaagctgcgctaaagcagagcctgat
gcagaggctgaacagaatggaaaggatgagcccgagaggctaagtgggtcccggaagacc
agggactcagtgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107507932
Entry
107507932         CDS       T06036                                 

Gene name
KCNJ9
Definition
(RefSeq) G protein-activated inward rectifier potassium channel 3
  KO
K05002  potassium inwardly-rectifying channel subfamily J member 9
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04713  Circadian entrainment
ray04723  Retrograde endocannabinoid signaling
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04915  Estrogen signaling pathway
ray04921  Oxytocin signaling pathway
ray04929  GnRH secretion
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107507932 (KCNJ9)
   04915 Estrogen signaling pathway
    107507932 (KCNJ9)
   04921 Oxytocin signaling pathway
    107507932 (KCNJ9)
  09156 Nervous system
   04728 Dopaminergic synapse
    107507932 (KCNJ9)
   04726 Serotonergic synapse
    107507932 (KCNJ9)
   04723 Retrograde endocannabinoid signaling
    107507932 (KCNJ9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107507932 (KCNJ9)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107507932 (KCNJ9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107507932 (KCNJ9)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107507932 (KCNJ9)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 107507932
NCBI-ProteinID: XP_015994866
LinkDB
Position
Unknown
AA seq 393 aa
MAQENAAFAAGPEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTTWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFETGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHQTFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGGGVGADKEQNGCLPPPESESKV
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggcacaggagaacgccgccttcgccgctggccccgaggagccaccgcggcgtcgcggc
cgccagcgatacgtggagaaggacggccggtgcaacgtgcagcagggcaacgtgcgcgag
acgtaccgctacctgacggacctgttcaccactctggtggacctgcagtggcgcctcagc
ctgctcttcttcgtcctcgcctacgcactcacctggctcttcttcggcgccatctggtgg
ctcatcgcctacggccgcggggacctggagcacctggaggacacgacctggacgccatgc
gtcaacaacctcaacggcttcgtggccgcctttctcttctccatcgagacagagaccacc
atcggctacgggcaccgcgtcatcaccgaccagtgccccgagggcatcgtgctgctgctg
ctgcaggccatcctgggctctatggtgaatgccttcatggtgggctgcatgttcgtcaag
atctcacagcccaacaagcgtgccgccacgctcgtcttctcctcgcacgcggtggtgtca
ctgcgcgacggccgcctctgtctcatgttccgcgtgggcgacctgcgctcttctcacatc
gttgaggcctccatccgcgctaagctcatccgctcgcgccagacgcttgagggcgagttc
atcccgctgcaccagaccgacctcagcgtgggcttcgagacgggcgacgatcgcctcttc
cttgtctcgccgctcgtcatcagccacgagatcgatgctgccagccccttctgggaggcg
tcgcgccgcgccctcgagagggacgacttcgagatcgttgtcatcctcgagggcatggtg
gaagccacgggaatgacatgccaagctcggagctcctacctggtggatgaggtgctgtgg
ggtcaccgcttcacatcagttttgaccctggaggacggtttctacgaggtggactatgcc
agcttccaccagacctttgaggtgcccacaccctcgtgcagcgcccgggaactggctgag
gcagcagcccgccttgatgcccatctctactggtccatccccagtcggctggatgagaag
gtggaggaggaaggggctggggagggggcagggggaggagttggggctgacaaggaacag
aatggctgcctgcctcccccagagagtgagtccaaggtgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521176
Entry
107521176         CDS       T06036                                 

Gene name
KCNJ3
Definition
(RefSeq) G protein-activated inward rectifier potassium channel 1 isoform X1
  KO
K04997  potassium inwardly-rectifying channel subfamily J member 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04713  Circadian entrainment
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04915  Estrogen signaling pathway
ray04921  Oxytocin signaling pathway
ray04929  GnRH secretion
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    107521176 (KCNJ3)
   04915 Estrogen signaling pathway
    107521176 (KCNJ3)
   04921 Oxytocin signaling pathway
    107521176 (KCNJ3)
  09156 Nervous system
   04724 Glutamatergic synapse
    107521176 (KCNJ3)
   04725 Cholinergic synapse
    107521176 (KCNJ3)
   04728 Dopaminergic synapse
    107521176 (KCNJ3)
   04726 Serotonergic synapse
    107521176 (KCNJ3)
   04723 Retrograde endocannabinoid signaling
    107521176 (KCNJ3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107521176 (KCNJ3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107521176 (KCNJ3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107521176 (KCNJ3)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   107521176 (KCNJ3)
SSDB
Motif
Pfam: IRK_C IRK
Other DBs
NCBI-GeneID: 107521176
NCBI-ProteinID: XP_016021128
LinkDB
Position
Unknown
AA seq 501 aa
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQSEQFEIVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAIANSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
VSRMEGNLPAKLRKMNSDRFT
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgtctgcactccgaaggaaatttggggacgattaccaggtagtgaccacctcgtccagc
ggctcgggcttgcagccccaggggccaggccagggcccacagcagcagcttgtgcctaag
aaaaagcggcagcggttcgtggacaagaacggccggtgcaatgtacagcacggcaacctg
ggcagcgagaccagccgctacctctcggacctcttcaccaccttggtggacctcaagtgg
cgctggaacctcttcatcttcatcctcacctacaccgtggcctggctcttcatggcgtcc
atgtggtgggtgatcgcctacactcggggcgacctgaacaaagcccacgtcggcaattac
acgccctgcgtggccaatgtctataacttcccctccgccttcctcttcttcatcgagacc
gaggccaccatcggctacggctaccgctacatcaccgacaagtgccccgagggcatcatc
ctcttcctcttccagtccatcctcggctcgatcgtggacgccttcctcattggctgcatg
ttcatcaagatgtcccagcccaagaagcgcgcggagacccttatgttcagtgagcacgcg
gtgatttccatgagggacggaaaactcacgctcatgttccgggtgggcaacctgcgcaac
agccacatggtctccgcgcagatccgctgcaagctgctcaaatctcggcagacacctgag
ggtgagttccttccccttgatcaacttgaactggatgtaggttttagtacaggggcagat
caactttttcttgtttcccccctcacgatttgccacgtgatcgatgccaaaagccccttt
tatgacctatcccagcgaagcatgcaaagtgaacagttcgagattgtcgtcatcctagaa
ggcattgtggaaacgactgggatgacttgccaagctcgaacatcatatactgaagatgaa
gttctttggggtcatcgtttttttcctgttatttccttagaagaaggattctttaaagtt
gattactctcagttccacgcaacattcgaagtccccaccccaccttatagtgtgaaagaa
caagaggaaatgcttcttatgtcatcccctttaatagcaccagccatagctaacagcaaa
gaaagacacaattctgtggaatgcttagatggactagatgatattagtacaaaacttcca
tctaagctgcagaaaattactggaagagaagactttcccaaaaaacttttgagaatgagt
tctactacttcagaaaaagcctacagtttgggagatttgcctatgaaacttcaacgaata
agttcagttcctggcaactcagaagaaaaactggtatctaaaaccaccaagatgttgtct
gatcccatgagccagtcagtggctgatttgccaccaaagcttcaaaagatggctggggga
gtttccaggatggaagggaatcttccagccaaattaagaaaaatgaactctgatagattc
acataa

DBGET integrated database retrieval system