KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499295
Entry
107499295         CDS       T06036                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1 isoform X1
  KO
K05719  integrin beta 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04145  Phagosome
ray04151  PI3K-Akt signaling pathway
ray04360  Axon guidance
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04514  Cell adhesion molecules
ray04530  Tight junction
ray04611  Platelet activation
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray05100  Bacterial invasion of epithelial cells
ray05133  Pertussis
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05222  Small cell lung cancer
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107499295 (ITGB1)
   04151 PI3K-Akt signaling pathway
    107499295 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107499295 (ITGB1)
   04514 Cell adhesion molecules
    107499295 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107499295 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107499295 (ITGB1)
   04530 Tight junction
    107499295 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107499295 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107499295 (ITGB1)
   04670 Leukocyte transendothelial migration
    107499295 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    107499295 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107499295 (ITGB1)
   05205 Proteoglycans in cancer
    107499295 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107499295 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107499295 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107499295 (ITGB1)
   05414 Dilated cardiomyopathy
    107499295 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107499295 (ITGB1)
   05133 Pertussis
    107499295 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    107499295 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107499295 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107499295 (ITGB1)
   05140 Leishmaniasis
    107499295 (ITGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107499295 (ITGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107499295 (ITGB1)
   04515 Cell adhesion molecules [BR:ray04515]
    107499295 (ITGB1)
   04090 CD molecules [BR:ray04090]
    107499295 (ITGB1)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    107499295 (ITGB1)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107499295 (ITGB1)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin beta subunits
   107499295 (ITGB1)
CD molecules [BR:ray04090]
 Proteins
  107499295 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 107499295
NCBI-ProteinID: XP_015978839
LinkDB
Position
Unknown
AA seq 798 aa
MNLQLIFWIGLISSICYVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCHPDDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFALKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPNKNSETIKIKPLGFTEEVEIILQFICECECQSEGIPGSPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPDYTGSACDCSLDTTSCM
ATNGQICNGRGICECGTCKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNITKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEAIVHVVET
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttacagctgattttctggattggactgatcagttcaatttgctatgtatttggc
caagcagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtggatggtgtacaaattcaacatttttacaagaagggatgcctact
tctgcacgatgtgatgatttagaagccttaaaaaagaagggctgtcatccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctccagccagaagatatcactcaaatccaaccacaacagttggtt
ttacaattaagatcaggagagccgcagacgtttgcattaaaattcaagagagctgaagac
tatcctattgatctctactacctaatggacctttcttactctatgaaagatgacttggag
aatgtgaaaagtcttggaacagatctgatgaatgaaatgaggaggattacttcagacttt
cgaattgggtttggctcgtttgtggagaaaactgtgatgccttacattagtacaacacca
gctaagctcaggaacccttgcacaagtgaacagaattgtaccagcccatttagctacaaa
aatgtgcttagtcttactgataaaggggaagtgtttaatgaacttgttggtaaacagcgt
atatctggaaatttggattctccagaaggtggctttgatgcaatcatgcaagttgcagtt
tgtgggtcattaattggctggaggaatgtcacacggctactggtgttttccacggacgct
ggctttcacttcgccggagatgggaaacttggtggcattgttttaccaaatgatggacag
tgtcacttggaaaatgatgtatacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactaagtgaaaataacattcagacgatttttgcagttactgaagaa
tttcagcctgtttacaaggaactgaaaaatttgattcctaagtcagcagtaggaacatta
tctgcaaattccagcaatgtgattcagttgatcattgatgcatacaactctctttcctca
gaagtcatattggaaaatagcaaattgccagaaggagtaacaataaattacaaatcttac
tgcaagaatggggtgaatggaacaggggaaaatggaagaaaatgctccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataaatgtccgaataagaattct
gaaaccattaaaattaagcctctgggcttcactgaggaagtagagattattcttcagttc
atctgtgaatgtgagtgtcaaagtgaaggcatccctggcagtccaaagtgtcatgaagga
aatggaacgtttgagtgcggagcttgcaggtgcaatgagggacgtgttggcagacattgt
gaatgcagcacagatgaagttaacagtgaagatatggatgcttactgcaggaaagaaaac
agttcagagatctgtagtaacaatggcgaatgtgtctgtggacaatgtgtttgtaggaag
agggataatacaaatgaaatttattctggaaaattctgcgagtgtgataatttcaactgt
gatagatccaacggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgaa
tgcaaccccgactacacgggcagtgcatgtgactgttctctggacacgacttcatgcatg
gccacaaatggacagatctgtaatggccggggcatctgtgagtgtggcacgtgtaagtgc
acggatcccaagtttcaggggccgacttgtgagatgtgtcagacctgccttggcgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaggataca
tgtgcacaggaatgttcccatttcaacattaccaaggtcgaaaatcgggataaattaccc
cagccaggccaggtggatcccctgtcccactgtaaagagaaggatgttgatgattgctgg
ttctatttcacatattccgtgaatgggaacaatgaagccatcgttcacgttgtagagact
ccagagtgtcctactggtccagacatcattcccattgtagctggtgtggttgcaggaatt
gttctgattggccttgcattgctgctgatttggaagcttttaatgataattcatgacaga
agggaattcgccaaatttgaaaaggaaaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataaaagtgccgtgacaactgttgtcaatccaaagtatgagggaaaatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501601
Entry
107501601         CDS       T06036                                 

Gene name
ITGB4
Definition
(RefSeq) integrin beta-4
  KO
K06525  integrin beta 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107501601 (ITGB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107501601 (ITGB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107501601 (ITGB4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107501601 (ITGB4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107501601 (ITGB4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107501601 (ITGB4)
   05414 Dilated cardiomyopathy
    107501601 (ITGB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107501601 (ITGB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107501601 (ITGB4)
   04515 Cell adhesion molecules [BR:ray04515]
    107501601 (ITGB4)
   04090 CD molecules [BR:ray04090]
    107501601 (ITGB4)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107501601 (ITGB4)
  Exosomal proteins of bladder cancer cells
   107501601 (ITGB4)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin beta subunits
   107501601 (ITGB4)
CD molecules [BR:ray04090]
 Proteins
  107501601 (ITGB4)
SSDB
Motif
Pfam: Integrin_beta fn3 Calx-beta Integrin_B_tail PSI_integrin I-EGF_1 Pur_ac_phosph_N EGF_2 SEA
Other DBs
NCBI-GeneID: 107501601
NCBI-ProteinID: XP_015983402
LinkDB
Position
Unknown
AA seq 1802 aa
MAGPCASPWTRLLLAALLSVSFPADMANRCKKAQVKSCTECIRVDKDCAYCTDQMFKERR
CNTQTELLAAGCRPEGIMVMESSFEITEETQIDTTLRRSQVSPQALRVRLRPGEERHFEL
EVFEPMESPVDLYILMDFSNSMSDDLDNLKQMGQHLAQVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDAPFSFKNVISLTDDVDEFRRKLQGERVSGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDEKCHLDPTGAYTQYR
TQDYPSVPALVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLQ
EAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTKSGSFHIRRGQVGTYQVQLRAIEDADG
THVCQLPEDDRQGGIHLKPSFSDGLRMDVGIICAVCSCELVRQTLSPHCHFHGDFMCGHC
VCNEGWSGSNCNCSTGSLSDTQPCLREGDDKPCSGQGECQCGHCVCYGDGRYEGQFCEHD
NSQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECG
RCHCNQQSLYTDTTCEINYSAVRLGLCEDLRSCVQCQAWGTGEKKGRTCEECSFKVKMVD
ELKNAEEVVEYCSFRDEDDDCNYSYTVEGDGTPGPNSTVLVHRQKDCPPGSFWWLIPLLI
FLLLLLPLLLLLCWKYCACCKACLGLLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPML
RSGNLKGRDMVRWKVTNNVQRPGFATHAASTNPTELVPYGLSLRLARLCTENLLKPDTRE
CDQLRQEVEENLNEVYRQVAGAHKLQHTKFRQQPNAGKKQDHTIVDTVLMAPRSAKQSLL
KLTEKQVAQGAFHELKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFVRPEDDDEKQ
LLVEAIDVPVGTATLGRRLVNITIIKEQASGIVSFEQPEYLVSGGEQMARVPVIRRILDS
GKSQVSYRTQDVTAKAHRDYIPSEGELLFQPGETWKEIQVKLLELQEMDSLLRGRQTRRF
HIQLSNPKFGARLGQPHSATVIIGDQDDLDRNFKSQTLTSLSSPRGDLGAPQNPNAKAAG
SRKIHFNWLPPPGKPAGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAY
GAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGL
VNEDNRPIGPMKKVLVDGPKRRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ
PKRPMSIPIIPDIPIVDAQSGGDYESFLMYSDDVLRSPAGSQRPSVSDDTEHLVNGRMDF
AFPGSANSLHRMTTSNATSYGTHLSPHLPHRMLSTSSTLTRDYHSLTRTEHSGTLPRDYS
TLTSLSSHSLPPIWEDGRSRLPLSWALGSWSRAQTKGFPPSRDSRDSIILAGRPTAPSWG
PGSRLAAGIPNTPTRLVFSALGPTSLKVSWQEPQCERALQGYSVEYQLLNGGELHRLNIP
NPSQTSVVVGDLLPNHSYVFRVRAQSQEGWGPEREGVITIESQVHPQSPLCPLPGSAFTL
STPSAPGPLVFTALSPDSLQLSWERPRRPDGDILGYLVTCEMAHGGEPATTFLVDGDNPE
SRLTVPGLSENVPYKFKVQAKTTQGFGPEREGIITIESQDGGPFPQLGTHPGLLQQPLPG
EYSSISTTRTTEPFLLDGLTLGSQSLEAGGSLTRHVTQEFVSRTLTTSGTLSTQVDHQFF
QT
NT seq 5409 nt   +upstreamnt  +downstreamnt
atggccgggccttgtgccagcccatggaccaggctgctgctggcagccctgctgagtgtc
agcttccccgcggacatggcgaaccgctgcaagaaggcccaggtgaagagctgcaccgag
tgcatccgcgtggacaaagactgcgcctactgcaccgaccagatgttcaaagaacggcgc
tgcaacacccagacggagctgctggccgccggctgccggccggagggcataatggtcatg
gagagcagcttcgagatcacagaggagacccagatcgacaccaccctgcgacgcagccag
gtgtccccacaggccctgcgggtccgcctgcggccgggtgaggagcggcactttgagctg
gaggtgttcgagccgatggagagccccgtggacctctacatcctcatggacttctccaat
tccatgtccgacgatctggacaacctgaagcagatggggcagcacctggcccaggtcctg
agccagctcaccagcgactatactatcggatttggcaagttcgtggacaaagtcagcgtc
cctcagacagacatgaggcctgagaagctgaaggagccttggcccaacagtgacgccccc
ttctccttcaagaatgtcatcagcctgacggacgacgtggacgagttccggaggaaactg
cagggagagcgggtctcgggcaacctggacgcccccgagggcggtttcgacgccatcctg
cagacggccgtgtgcaccagggacattggctggcgcccggacagcacccacctgctggtg
ttctccaccgagtccgccttccactacgaggccgacggtgccaacgtgctggccggcatc
atgagccgcaacgacgagaagtgccacctggaccccacgggcgcctacacccagtacagg
acgcaggactacccctcggtgcccgcgctggtgcgcctgctcgccaagcacaacatcatc
cccatcttcgctgtcaccaactactcctacagctactacgagaagctgcacacgtatttc
cccgtgtcctcgctgggcgtgctgcaggaagactcgtccaacatcgtggagctgctgcag
gaggccttcaaccgcattcgctccaacctggacatccgggccctggacagcccccgtggc
ctgcggacagaggtcacctccaagatgttccagaagacaaagtctgggtcatttcacatc
cggagggggcaagtgggcacctatcaagttcagctgcgggccatcgaggacgcggatggg
acgcacgtgtgccagctgccagaggacgacaggcagggcggcatccacctgaagccttcc
ttctccgacggcctcaggatggacgtgggcatcatctgcgctgtgtgctcctgcgagctg
gtacggcagacgctgtcacctcactgccacttccacggagacttcatgtgcgggcactgt
gtgtgcaacgagggctggagcggcagcaactgcaactgctccacgggctcgctgagcgac
acgcagccgtgcctgcgggagggtgacgacaagccgtgctcggggcagggcgagtgccag
tgcggccactgcgtgtgctacggcgatggccgctacgagggccagttctgcgagcacgac
aactcccagtgtccccgcacctccgggttcctctgcaacgaccgggggcgctgctccatg
ggccagtgcgtgtgtgagcccggctggacaggcccgagctgtgactgtcctctcagcaac
gccacctgcatcgacagcaacgggggcatctgcaatgggcgtggccactgcgagtgtggc
cgctgccactgcaaccagcagtccctctacacagacaccacctgcgaaatcaactactca
gcggtccgtctggggctctgtgaggacctgcgctcctgcgtgcagtgccaggcctggggt
accggagagaagaaggggcgcacgtgtgaggagtgcagcttcaaagtcaagatggtggat
gagctgaagaacgcggaggaggtggtggagtactgctccttccgggacgaggacgatgac
tgcaactacagctacaccgtggagggtgacggcacccctgggcccaacagcaccgtcctg
gtgcacaggcagaaggactgccctcccggctccttctggtggctcatccccctgctcatc
ttcctcttgctgctcctgcccctgctgttgctgctctgctggaaatactgtgcctgctgc
aaggcctgcctgggacttctcccctgctgcaaccgaggtcacatggtgggcttcaaggaa
gaccactacatgctgcgggagaacctgatggcctcagaccacctggacacgcccatgctg
cggagcgggaacctcaaggggcgggacatggtgcgctggaaggtcaccaacaacgtgcag
cggcctggcttcgccacccacgccgccagcaccaaccccacggagctggtgccctacggg
ctgtcgctgcgcctcgcccgcctctgcaccgagaacctgctgaagccggacacgcgtgag
tgtgaccagctgcgccaggaggtggaggagaacctgaatgaggtgtacagacaggtcgca
ggcgcccacaagctccagcacacgaaattccggcagcagcccaacgctgggaaaaagcag
gaccacaccatcgtggacacggtgctgatggccccgcgctcggccaagcagtccctgctc
aagctgacggagaagcaggtggcacagggcgccttccacgagctcaaggtggcccccggc
tactacaccctcactgcggaccaggacgcccggggcatggtggagttccaggagggcgtg
gagctggtggacgtgcgggtgcccctcttcgtgcggcccgaggacgacgacgagaagcag
ctgctggtggaggccatcgatgtgcccgtgggcacggccaccctgggccgccgcctggtc
aacatcaccatcatcaaggagcaagccagcgggatagtgtcctttgagcagccggagtac
ttggtcagtggcggggagcaaatggcccgcgttccggtcatccggcgcatcctggacagc
ggcaagtctcaggtctcgtaccgcacgcaggacgtcaccgcaaaggcccaccgggactac
atcccctcagagggcgagctgctgttccagcctggggagacctggaaggagatacaggtg
aagctcctggagctgcaggagatggactccctcctgaggggccgccagacccgccgcttc
cacatccagctcagcaaccccaagtttggggcccgcctgggccagccccactcagccact
gtcatcatcggggaccaagacgacctggacaggaacttcaagagccagaccctgacatca
ctctcatcccctcgcggggacctgggtgccccacagaaccccaatgccaaggccgctggg
tcccggaagatccacttcaactggctgccccctcctggcaaaccagcagggtacagggtg
aagtactggatccagggcgactccgagtccgaagcccacctgctcgacagcaaggtgccc
tcagtggagctcaccaacctgtacccgtattgcgactacgagatgaaggtgtgcgcctac
ggggcgcagggcgagggtccctacagctccctggtgtcctgccgcacccaccaagaagta
cccagtgagccggggcgtctggctttcaacgtcgtctcctccaccgtgacccaactgagc
tgggctgagcccgccgaaaccaatggcgagatcacggcctatgaggtctgctacggcctg
gtcaacgaggacaaccgacccattgggcccatgaagaaggtgctggtggatggccccaag
aggcggatgctgctcatcgagaacctgcgggagtcccagccgtaccgctacacagtgaag
gcgcgtaacggggcgggctggggacccgagcgagaggccatcatcaacctggccacccag
cccaagcggcccatgtccatccccatcatcccggacatccccattgtggacgcccagagc
gggggagactacgaaagcttcctcatgtacagcgatgacgttctgcgctccccggctggc
agccagaggcccagtgtctccgacgacacagagcacttggtaaatgggcggatggacttt
gccttcccgggcagcgccaactccctgcacaggatgaccacgagcaacgcgacgagctac
ggcacccacctgagcccgcacctgccccaccgaatgctgagcacgtcctctaccctcacg
cgggactaccactcgctgacccgcacagagcactcgggcacgctgcccagggactactcc
accctcacctcgctctcctcccacagcctccctcccatctgggaagacgggaggagcagg
cttccgctgtcctgggccctggggtcctggagtcgggctcagacgaaggggttccccccc
tccagggactcacgagactctataatactggctgggcggccgacagcaccctcttggggc
ccaggctcccgcttggctgcgggcatacccaacacacccacccgcctggtgttctccgcc
ctggggcccacatctctgaaagtgagctggcaggagccgcagtgcgagcgggccctgcag
ggctacagcgtggagtaccagctgctgaatggcggagagctgcatcggctcaacatcccc
aaccccagtcagacttcggtggtggtgggcgacctcctgcccaaccattcctacgtgttc
cgcgtgcgggcccagagccaggaaggctggggcccggagcgagagggtgtcatcaccatt
gaatcccaggtgcacccccagagcccactctgccccctgccaggctccgccttcactttg
agcacgcccagtgccccaggcccgctggtgttcacggccctgagcccagactcgctgcag
ctgagctgggagcggccacgcaggcctgatggggatatcctgggctacctcgtgacctgt
gagatggcccatggaggagagccagccaccacgttcctggtggacggagacaaccccgag
agccggctgacagtgccaggcctcagtgagaacgtgccctacaagttcaaggtgcaggcc
aagaccacccaaggcttcggtccagagcgtgaggggatcatcaccatcgagtcccaggat
ggaggccccttcccgcagctgggtacccaccccgggctcctccagcagccactgcccggc
gagtacagcagcatcagcaccacccgcaccactgagcccttcctgctggatggactcacc
ttggggtcccagagcctggaagcaggtggctcccttactcgtcatgtgacccaggagttt
gtgagccggacactgactaccagcgggaccctcagcacccaggtggatcaccagttcttc
cagacctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501647
Entry
107501647         CDS       T06036                                 

Definition
(RefSeq) integrin beta-3
  KO
K06493  integrin beta 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04145  Phagosome
ray04151  PI3K-Akt signaling pathway
ray04380  Osteoclast differentiation
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04611  Platelet activation
ray04613  Neutrophil extracellular trap formation
ray04640  Hematopoietic cell lineage
ray04810  Regulation of actin cytoskeleton
ray04919  Thyroid hormone signaling pathway
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05168  Herpes simplex virus 1 infection
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107501647
   04151 PI3K-Akt signaling pathway
    107501647
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107501647
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107501647
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107501647
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107501647
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107501647
   04611 Platelet activation
    107501647
   04613  Neutrophil extracellular trap formation
    107501647
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107501647
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107501647
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107501647
   05205 Proteoglycans in cancer
    107501647
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107501647
   05410 Hypertrophic cardiomyopathy
    107501647
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107501647
   05414 Dilated cardiomyopathy
    107501647
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107501647
   05163 Human cytomegalovirus infection
    107501647
   05165 Human papillomavirus infection
    107501647
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107501647
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107501647
   04515 Cell adhesion molecules [BR:ray04515]
    107501647
   04090 CD molecules [BR:ray04090]
    107501647
Membrane trafficking [BR:ray04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    107501647
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107501647
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin beta subunits
   107501647
CD molecules [BR:ray04090]
 Proteins
  107501647
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 107501647
NCBI-ProteinID: XP_015983509
LinkDB
Position
Unknown
AA seq 645 aa
MDLSYSMKDDLWSIQNLGTKLASQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALKNPC
YDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDGPEGGFDAIMQATVCDEKIG
WRNDASHLLVFTTDAKTHIALDGRLAGIVRPNDGQCHVGSDNHYSSSTTMDYPSLGLMTE
KLSQKNINLIFAVTEEVVNLYQNYSELIPGTTVGVLSTDSSNVLQLIVDAYGKIRSKVEL
EVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFSIEAKVRGCPQEKEKSFTIK
PVGFKDSLTVQVTFDCDCACQAYAEPYSHHCNNGNGTFECGVCRCGPGWLGSRCECSEED
YRPSQQDECSPQEGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCS
GHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGNT
CEKCPTCPDACTFKKDCVECKKFNRGTLLEENTCNRYCRDEIESVKELKDTGKDAVNCTY
KNEDDCVIRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLATLLIWKL
LITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
NT seq 1938 nt   +upstreamnt  +downstreamnt
atggacctgtcttactccatgaaagatgacctgtggagcatccagaacctgggtaccaag
ctggcctcccagatgcgcaagctcaccagtaacttacggattggctttggggcctttgtg
gacaaacctgtgtcaccgtacatgtacatctctccaccagaggctctcaaaaacccctgc
tatgatatgaagaccacctgtttgcccatgtttggctacaaacatgtgctgacgctgact
gatcaggtgactcgcttcaatgaggaggtgaagaagcagagtgtgtcacggaaccgagat
ggcccagagggcggctttgatgccatcatgcaggcaacagtctgtgatgagaagattggc
tggaggaacgatgcatcccacttgctggtgtttaccactgacgccaagacccatatagcc
ctggatggaaggttggcaggcattgtccggcccaatgatgggcagtgtcacgttggcagt
gacaaccattactcttcctctactaccatggattatccctctctggggctaatgactgag
aagttatcccagaaaaatatcaatttgatctttgcagtgactgaagaagtagtcaacctc
taccagaactacagtgagctcatcccagggaccacagtgggggttctgtccaccgattcc
agcaatgtcctccagctcattgttgatgcttatgggaaaatccgctccaaagtagagctg
gaagtgcgtgaccttcctgaggagttgtctctgtccttcaatgctacttgtctcaacaac
gaggtcatcccaggcctcaagtcttgtgttggactcaagattggagacacggtgagcttc
agcattgaggccaaggtgcgcggctgcccccaggagaaggaaaagtccttcaccatcaag
cctgtgggctttaaggacagtctcactgtgcaggtcaccttcgactgtgactgtgcctgc
caggcctatgccgagccttacagccaccactgcaacaatggcaatgggacctttgagtgt
ggggtgtgccgctgtgggcctggctggctggggtcccggtgcgagtgctcagaagaggac
taccgcccctcccagcaggacgagtgcagcccccaggagggccagccagtctgcagccag
cggggcgagtgcctctgtggccagtgcgtctgccacagcagtgactttggcaagatcacg
ggcaagtactgtgagtgcgatgacttctcctgtgtccgctacaagggggagatgtgctca
ggacacggccagtgcagctgtggggactgcctgtgtgactctgactggaccggctactac
tgcaactgtaccacgcgcacggacacctgcatgtccagtaatgggctgctgtgcagcggc
cggggcaagtgtgaatgtggcagctgcgtctgcatccagccaggctcctatgggaacacc
tgtgagaagtgtcccacctgccctgatgcctgcacctttaagaaggattgtgtagagtgt
aagaagttcaaccggggaaccctgcttgaggaaaacacctgcaaccgttactgtcgtgat
gagatcgagtctgtgaaggagctcaaggacactggcaaggatgcagtgaattgtacctat
aagaatgaggatgactgcgtcatcagattccagtactacgaagactccagtggcaagtcc
atcctatatgtggtagaagagccagagtgtcccaagggccccgacatcctagtggtcctg
ctttcagtgatgggggccattctgctcatcggccttgctactctgctcatctggaagctc
ctcattaccattcatgatcggaaggaatttgcaaaatttgaggaagagcgagccagagca
aaatgggacacggctaacaacccactgtataaggaagccacatccaccttcaccaacatc
acctaccggggcacttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505238
Entry
107505238         CDS       T06036                                 

Gene name
ITGB5
Definition
(RefSeq) integrin beta-5
  KO
K06588  integrin beta 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05205  Proteoglycans in cancer
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107505238 (ITGB5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107505238 (ITGB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107505238 (ITGB5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107505238 (ITGB5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107505238 (ITGB5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107505238 (ITGB5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107505238 (ITGB5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107505238 (ITGB5)
   05414 Dilated cardiomyopathy
    107505238 (ITGB5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107505238 (ITGB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107505238 (ITGB5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ray04515]
    107505238 (ITGB5)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    107505238 (ITGB5)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin beta subunits
   107505238 (ITGB5)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 107505238
NCBI-ProteinID: XP_015990669
LinkDB
Position
Unknown
AA seq 800 aa
MPRAPAPLYACLLGLCAFVPGLPGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSV
ISRCDLRANLVRNGCEGEFESPASSTQVLRSLPLSSKGSGSAGSDVIQMTPQEIAVDLRP
GDKTAFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRNLGTKLAEEMRKLTSNFRLGFG
SFVDKSISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAILQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYTLYKNFTALIPGTTVEIL
HGDSNNVIQLIVNAYSSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
TVSFEVSVEARSCPGKHMEHVFTLRPVGFRDSLEVGVTYNCQCGCSTGLELDSPRCSGNG
TYVCGLCECNPSHLGTRCECQEGESQSGYQNLCREAEGKPLCSGRGECSCNQCSCFESEF
GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCQGKDGQ
ICSSRGHCVCGQCQCTEPGAFGETCEKCPTCPDACSTKRDCVECLLLHSGSPADNQTCQN
LCKDEVITWADSIVKDDQEAVLCFYKTAKDCVMLFTYAELPSGKSNLTVLREPECGTAPN
AMTILLAVVGSILLIGIALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIS
THTVDFTFNKFNKSYNGSVD
NT seq 2403 nt   +upstreamnt  +downstreamnt
atgccgcgggccccggcgcccctgtacgcctgcctcctcgggctttgcgcgttcgtgccc
gggctcccaggtcttaacatatgcactagtggaagtgccacttcctgtgaagaatgtctg
ctaatccaccccaaatgtgcctggtgctccaaagaggacttcggcagcccgcggtccgtc
atctctcggtgtgacttgagggcgaacctggtcagaaacggctgtgaaggcgagtttgag
agcccagccagcagcactcaggtcctgcggagcctgcctctcagcagcaagggctccggc
tctgctggctcagatgtcattcagatgacaccccaggagatcgcggtggacctgcggcct
ggtgacaagactgccttccagctgcaggttcgacaggtggaggattatcccgtggacttg
tactacctgatggacctctccctgtccatgaaggatgacttggacaacatccggaacctg
ggcactaaacttgccgaggagatgaggaagctcactagcaacttccgattggggttcggg
tcttttgtagacaagagcatctctcctttttcctatacagcaccgaggtaccagaccaat
ccatgcattgggtacaagttattcccaaactgcgtcccttcctttgggttccgccatttg
ctgcctctcacagacagagttgacagcttcaatgaggaagttcggaaacagagggtgtcc
cggaaccgtgatgctcccgaggggggctttgatgcaatactccaggcagccgtctgcaag
gagaagatcggctggcgaaaggatgcactgcacttgctggtcttcacaacagacgacgtg
cctcatatcgcactagatggaaaactggggggcctggtgcagccacacgacggccagtgc
cacctgaacgaggccaacgagtacactgcgtccaatcaaatggactacccatcccttgct
ttgcttggagagaagttggcagagaacaatatcaacctcatctttgcagtgacgaaaaac
cattatacactctacaagaattttacagccctgatacctggaacaactgtggagatttta
catggagactccaacaatgttattcaactgattgtcaatgcatacagtagcatccggtct
aaggtagagctgtcggtctgggatcagcctgaggatcttaacctattcttcactgccacc
tgccaggacggtgtatcctaccctggtcagaggaagtgtgagggcctgaagattggtgat
acggtgtccttcgaggtgtcggtggaggcccggagctgcccaggcaaacacatggagcac
gtgttcaccctgcggcccgtggggttccgggacagcctggaggtgggcgtcacctacaac
tgccagtgtggctgcagcacagggctggagctggacagccccagatgcagcgggaatggg
acttacgtctgcggcctgtgcgagtgcaaccctagccacctgggcaccaggtgtgagtgc
caggaaggggagagccagagcgggtaccagaacctgtgccgggaagcggagggcaagccc
ctgtgcagcgggcgcggcgagtgcagctgcaaccagtgctcctgcttcgagagcgagttt
gggaagatctacgggcccttctgcgagtgcgacaacttctcctgcgccaggaacaaagga
gtcctctgctcaggccatggcgagtgtcattgtggagaatgcaagtgccatgcaggttac
attggggacaactgtaactgctcaacagacatcagcacttgccagggcaaggacggccag
atctgcagcagccgggggcactgtgtctgtgggcagtgccagtgcacagagccgggagcc
tttggggagacgtgtgagaagtgcccaacctgcccagatgcttgcagcaccaagagagat
tgtgttgagtgcttgctgcttcactcagggagcccagctgacaaccagacctgccaaaac
ctgtgcaaggatgaggtgatcacatgggcggacagcatcgtgaaagatgaccaggaggca
gtgctttgtttctacaaaactgccaaggactgtgtcatgctgttcacctatgcagagctg
cccagtgggaagtccaacctgacggtcctcagggagccagagtgtggaacagcccccaat
gccatgaccatcctcctggccgtcgtaggcagtatcctcctgattgggattgcgctcctg
gccatctggaagcttctggtcaccatccacgaccggagagagtttgcaaagttccagagt
gagcgatccagggcccgctatgaaatggcttcaaaccctctgtacagaaagcccatctcc
acacatactgtggatttcaccttcaacaagttcaacaaatcctacaatggctcagtggac
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509843
Entry
107509843         CDS       T06036                                 

Gene name
ITGB7
Definition
(RefSeq) integrin beta-7 isoform X1
  KO
K06590  integrin beta 7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04514  Cell adhesion molecules
ray04672  Intestinal immune network for IgA production
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05202  Transcriptional misregulation in cancer
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107509843 (ITGB7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107509843 (ITGB7)
   04514 Cell adhesion molecules
    107509843 (ITGB7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107509843 (ITGB7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107509843 (ITGB7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    107509843 (ITGB7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107509843 (ITGB7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107509843 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107509843 (ITGB7)
   05414 Dilated cardiomyopathy
    107509843 (ITGB7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107509843 (ITGB7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107509843 (ITGB7)
   04515 Cell adhesion molecules [BR:ray04515]
    107509843 (ITGB7)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107509843 (ITGB7)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin beta subunits
   107509843 (ITGB7)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 107509843
NCBI-ProteinID: XP_015998182
LinkDB
Position
Unknown
AA seq 891 aa
MIYSAPVVRCSKDELPCFLRPDPCINSLGPVLPLSAPLSRSVTPSKFPPPRACHFLLCSL
SDQYTKAAAADGGKAALLAPGFILQIHLHTCETMVALSMVLVFLLVLSRSESELDTKISS
PGEATDWGDPDLSLPGSCQPAPSCQKCILSHPTCAWCKQLNFTASGEAEARRCARREELL
ARGCPVGELEEPRSRQEVLQDEPLSQGARGEGATQLAPQRVRVTLRPGEPQQLRVRFLRA
EGYPVDLYYLMDLSYSMKDDLEFVRQLGHALLVRLQEVTHSVRIGFGSFVDKTVLPFVST
VPSKLRHPCPTRMERCQPPFSFHHVLSLTGDAKAFEREVGRQSVSGNLDSPEGGFDAILQ
AALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHLDSNGLYSRSPEFDY
PSVGQVAQALSAANIQPIFAVTSATLPVYQELSKLIPKSAVGELSENSSNVVQLIMDAYN
SLSSTVTLEHSPLPPGVLISYESQCGGPEKRDGGAADRGQCNNVRINQMVNFLVTLQATQ
CLQEPHLLRLRALGFSEELTVELHTLCDCNCSDTQLQAPYCSDGQGHLQCGVCSCAPGRL
GRFCECSEAELSSLDLESGCRAPNGTGPLCSGKGQCQCGRCSCSGQSSGHLCECDDASCE
RHEGILCGGFGRCQCGVCHCHANRTGRACECSGDMDGCVSPKGGLCNGHGHCKCNRCQCL
DGYYGVLCDQCPSCKTPCERHRDCAECGAFETGPLATNCSMACAHANVTLALAPILDDGW
CKERTLDNQLLFFLVEDEAGGRVVLRVRPREKGADHTQAIVLGCVGGIVAVGLGLVLAYR
LSVEIYDRREYSRFEKERQQLNWKQDSNPLYKSAITTTVNPRFQETESPLL
NT seq 2676 nt   +upstreamnt  +downstreamnt
atgatatactcagcacctgttgttaggtgttcaaaagatgagcttccttgctttcttcgt
ccagatccttgtatcaactcccttggcccagttctacccttgtctgctccactttctaga
tcagtcaccccctccaagtttcccccaccccgggcgtgtcacttcctcctctgtagcctc
tcagatcagtacacaaaggctgctgctgcggatggaggaaaggctgctctgctcgcacct
ggatttatcctacagattcacttgcacacgtgtgaaaccatggtggctttgtcaatggtc
cttgttttcctgctggtcctgagcagaagtgagagtgagttggacaccaagatctcatcc
ccaggggaggccacagactggggggatcctgatctgtccctgccggggtcctgccagcca
gccccctcctgccagaagtgcatcctctcacatccaacctgtgcatggtgcaagcaactg
aacttcacagcgtcgggggaggcagaggcacggcgctgcgcccggagagaggagctgctg
gctcggggctgccctgtgggggagctggaggagccccgaagccggcaggaggtgcttcag
gatgagccgctcagccagggtgcccgtggagaaggggccacccagctggcgccacaacgg
gtgcgggtcacactgcggccgggggaacctcagcagctccgggtccgcttccttcgcgct
gagggataccctgtggacctgtactaccttatggacctgagctattccatgaaggatgac
ctggagttcgtacgccaacttgggcatgcactgctagtgcgactgcaggaggtcacacat
tctgtgcgcattggctttggctcctttgtggacaaaacggtgctgccctttgtgagcaca
gtgccctccaagcttcgccacccctgccccacccggatggagcgctgccagccacccttc
agctttcaccatgtgctgtccctgactggggatgccaaagcctttgagcgggaggtgggg
cgccagagtgtgtccggcaacctggactcacctgagggtggctttgatgccattctgcag
gctgcactctgccaggaacagattggctggagaaatgtttcccggctgctggtgttcact
tcagatgacacattccacacagctggggatgggaagttgggtggcattttcatgcccagt
gatgggcactgccacttggacagcaatggcctctacagtcgcagtccagagtttgactac
ccctctgtgggtcaggtagcccaggctctctctgcagcaaacatccagcccatctttgct
gtcaccagtgccacactgcctgtctaccaggagctgagtaagctgattcctaagtctgca
gtaggagagctgagtgagaactccagcaatgtggtgcagctcatcatggacgcttataat
agcctgtcatccactgtgactctcgaacactctccactccctcctggtgtcctcatctct
tatgaatctcagtgtgggggtcctgagaagagggatggtggggctgcggaccgaggccag
tgcaacaatgtccgaatcaaccagatggtgaattttttggttactctccaagctacccaa
tgcctccaagagccccatcttctgaggttacgagcccttggcttctcagaggagctgact
gtggagttacatacactgtgtgactgtaattgtagtgatactcagctccaggctccctac
tgcagtgatggccagggacacctacaatgcggggtgtgcagttgtgcccccggccgccta
ggtcgattctgtgaatgctctgaggctgagctctcctccttggatctggaatctgggtgc
cgagccccgaatgggacagggcccttgtgcagtgggaaaggacagtgccagtgtggacgc
tgcagttgcagtggacagagctcggggcacctgtgcgagtgtgatgatgccagctgtgag
cgacatgagggcatcctctgtggaggctttggccgctgccaatgtggagtgtgtcactgt
cacgccaaccgcacgggcagagcgtgtgaatgcagtggggacatggatggctgtgtcagt
cccaagggagggctctgcaatgggcatggacactgcaaatgcaaccgctgccagtgcttg
gatggctactatggtgtcctatgtgatcagtgcccaagctgcaagacaccatgtgagaga
cacagggactgtgcagagtgtggggcctttgaaactggtcctctggccaccaactgcagc
atggcttgtgctcatgccaacgtgactctggctctggcacctatcctggatgatggctgg
tgcaaagagaggaccctggacaaccagctgctgttcttcctggtagaggatgaagctgga
ggcagggtcgtgctgagagtgagaccccgagagaagggagcagaccacacccaggccatt
gtgctaggctgtgtggggggcattgtggcagtgggactggggctggtcctggcttaccgg
ctctcagtggaaatctatgaccgtcgagaatatagtcgttttgagaaggaacggcagcag
ctcaattggaagcaggacagcaatcctctctacaaaagtgccatcacgaccactgtcaat
ccacgctttcaagaaacagagagtccccttctctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514780
Entry
107514780         CDS       T06036                                 

Gene name
ITGB6
Definition
(RefSeq) integrin beta-6 isoform X1
  KO
K06589  integrin beta 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107514780 (ITGB6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107514780 (ITGB6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107514780 (ITGB6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107514780 (ITGB6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107514780 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107514780 (ITGB6)
   05414 Dilated cardiomyopathy
    107514780 (ITGB6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107514780 (ITGB6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107514780 (ITGB6)
   04515 Cell adhesion molecules [BR:ray04515]
    107514780 (ITGB6)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   107514780 (ITGB6)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin beta subunits
   107514780 (ITGB6)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 107514780
NCBI-ProteinID: XP_016008283
LinkDB
Position
Unknown
AA seq 868 aa
MVFLPKTFDNRYSNESQHFLKLKVCPERKLWENHGKGIKGPGCHEAAFCLMPEKGTAESI
SILCKGFNNGIQKSQRELKRMGIELLCLFFLFLGRNDHVQGGCAMGGAETCEDCLLIGPQ
CAWCSQENFTHPSGVGERCDTWANLLAKGCQLTFIENPVSQVEILTNKPLSVGRQKNSSS
IVQIAPQSLILKLRPGSEQTLQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLS
KEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDA
ERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDS
KLAGIVIPNDGLCHLDSNNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYEN
YAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVSGDTEGLNLSFTAICKNGTFF
SHQKKCSHMKVGDTASFNVTVSIPNCERRNRRIVIKPVGLGDTLEILVTPECNCDCQKEV
EVNSSKCHNGNGSFQCGVCACNPGYMGPRCECGEDTLSTDSCKEAPDHPSCSGRGDCYCG
QCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGDHGDCECGECVCKSGWAGEYCNCTTST
DSCLSEDGVLCSGRGDCVCGKCVCMNPGASGPTCERCPTCGDLCNSKRSCIECHLSADGL
VLEECVDKCKLAGVTINEEEDFSKDSSVSCSLQGENECLITFLITTDNEGKTIIHSINEK
DCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNP
LYRGSTSTFKNVTYKHREKQKVDLSTDG
NT seq 2607 nt   +upstreamnt  +downstreamnt
atggtatttctgccaaagacttttgataaccggtacagtaatgaatctcagcactttctg
aaattaaaggtctgccctgagaggaagctctgggaaaatcatggaaagggaatcaaagga
cctggctgccatgaagctgctttctgtctgatgccagaaaaaggaacagcagagtccatt
tcaattctctgcaaaggatttaacaatggaatacaaaaatctcagcgagaactgaaacga
atggggattgaactgctttgcctgttctttctatttttaggaaggaatgatcacgtacaa
ggtggctgtgccatgggaggtgcagaaacctgtgaagactgcttactcattggacctcag
tgtgcctggtgttctcaggagaattttacccatccatctggagttggtgaaagatgtgat
acctgggcaaatcttttagctaaaggatgtcaactaaccttcatcgaaaaccctgtctcc
caagtagaaatacttacaaataagcctctcagtgtaggcagacaaaaaaacagttccagc
attgttcagattgcacctcaaagcttgattcttaaattgagaccaggcagtgaacagact
cttcaagtgcaagtccgccagaccgaggattatccagtggacttgtattacctcatggac
ctctcagcctccatggatgacgacctcaacacaatcaaagagctgggctccctgctttcc
aaggaaatgtctaaattaactagcaactttagactgggctttggctcttttgtggaaaag
cccgtctccccttttgtgaaaacaacgccagaagaaattgccaacccttgtagtagtatt
ccatatttctgcttacctacatttggattcaagcatattttgccactaacaaatgatgca
gagagattcaatgaaattgtgaagaatcagaaaatttctgctaatattgacacacctgaa
ggtggatttgatgcaattatgcaagctgctgtgtgtaaggaaaaaattggctggcggaat
gactccctccatctcctggtctttgtgagtgatgctgattctcattttggaatggacagc
aaactggcaggcatcgtcattccgaatgatggactctgtcacttggacagcaacaatgaa
tactccatgtcaactgtcttggagtatccgacaattggacaactcattgataaactggtg
caaaataacgtgttactcatctttgccgtaacccaagaacaagttcatttatatgagaat
tatgcaaaactcattcctggagctacagtagggctacttcagaaagactctggaaacatt
ctccagctgatcatctcggcttatgaagaattgcgatctgaggtggaactggaagtatca
ggagacacagaaggactcaatctgtcattcacagctatatgtaaaaacgggaccttcttc
tcacaccaaaagaaatgttctcacatgaaggtgggagacacagcttcatttaatgtgact
gtgagtataccaaactgtgagagaagaaacaggcgcatcgttataaagcctgtggggctg
ggggacaccctagaaatacttgttactccggaatgcaactgtgactgtcagaaagaagtg
gaagtgaacagctccaaatgccacaatgggaatggttctttccagtgtggggtgtgcgct
tgcaaccctggctacatgggtcctcgctgtgagtgtggagaggacacgctgagcacagat
tcctgcaaggaggccccggatcatccctcatgcagtggaagaggcgattgctactgtgga
cagtgcatctgccatttatctccctatggaaacatttacgggccttactgccagtgtgac
aatttctcctgcgtgagacacaaagggctgctctgtggagatcacggcgactgtgagtgc
ggtgagtgcgtgtgcaagagcggctgggccggcgagtactgcaactgcactaccagtacg
gactcgtgcctctctgaagatggggtgctctgcagcggccgaggggactgcgtttgtggc
aagtgtgtttgcatgaaccctggagcctcaggaccgacctgtgaacgttgtcctacctgt
ggcgatctctgtaactctaaacggagctgcattgaatgccacctgtctgcagatggcctg
gtgctagaagaatgtgttgacaaatgcaaactagctggtgtgaccatcaacgaagaagaa
gatttctcaaaggatagttctgtttcctgttctctgcaaggagaaaatgaatgtcttatt
acattcctaataactacagataacgaaggaaaaaccatcattcacagcatcaatgagaaa
gactgtccaaaacctccaaacattcctatgatcatgttgggggtttcactggctattctt
ctcattggggttgtcctactgtgcatttggaagctgctggtatcgtttcatgatcgtaaa
gaagttgccaaatttgaagcagaaaggtcaaaggccaagtggcaaacgggaaccaatcca
ctgtacagaggctccaccagtacctttaaaaatgtaacctacaaacacagagaaaaacaa
aaggtcgacctttccacggatggatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518140
Entry
107518140         CDS       T06036                                 

Gene name
ITGB8
Definition
(RefSeq) integrin beta-8 isoform X1
  KO
K06591  integrin beta 8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04514  Cell adhesion molecules
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107518140 (ITGB8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107518140 (ITGB8)
   04514 Cell adhesion molecules
    107518140 (ITGB8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107518140 (ITGB8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107518140 (ITGB8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107518140 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107518140 (ITGB8)
   05414 Dilated cardiomyopathy
    107518140 (ITGB8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107518140 (ITGB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107518140 (ITGB8)
   04515 Cell adhesion molecules [BR:ray04515]
    107518140 (ITGB8)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107518140 (ITGB8)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin beta subunits
   107518140 (ITGB8)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 Sigma_reg_N EGF_Tenascin
Other DBs
NCBI-GeneID: 107518140
NCBI-ProteinID: XP_016015052
LinkDB
Position
Unknown
AA seq 767 aa
MCRSALAFFTAVFVCLQNCRPGPAPFLRAAWVFSVVFGLGQSENNRCASSNAASCTRCLA
LGPECGWCAQEDFISGGSRSERCDIVSNLISKGCSTDSIEYPSVHVIPSENEINTQVTPG
EVLIQLRPGAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSKKMSFFS
RDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVV
PNDGNCHLKNNVYVRSTSMEHPSLGQLSKKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVKGIYLNITAICPNGTRKLGTDGCGN
VTSNDEVLFNVTVTMRKCDVTGGKSYAIIKPIGFNETTKIHIHRNCSCQCDDSRGPKRKC
IDENFLDSKCFQCDENKCHFDEDQFPSESCKSHKDQPVCSGRGVCICGKCLCHKIKLGKV
YGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSTSAQHCINPKGQVC
SGRGTCVCGRCECTDPRSIGRFCEHCPTCHTACNENWNCVQCLHPHNLSQAILDRCKTSC
TFMEQHYADQTSECFSTPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSADY
RVSASKKDKLILQSVCTRAVTYRREKPEEIKMDIGKLNAHETFRCNF
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgtgccgctcagccctggcattttttactgccgtatttgtctgtctgcaaaactgccgg
cctggtcctgccccattcctccgggcagcctgggtattttcagttgtttttggactgggc
caaagtgaaaacaatagatgtgcatcttcaaatgcagcatcctgcaccaggtgccttgct
ctgggtccagaatgtggatggtgtgctcaagaggatttcatttcaggtggatcaaggagt
gaacgttgtgatattgtttccaatttaataagtaaaggctgctcgacagattcaatagaa
tacccatcagtgcacgtaataccaagtgaaaatgaaatcaatacccaagtgacaccagga
gaagtgttgatccagcttcgtccaggagctgaagctaattttatgctgaaaattcatcct
ctgaagaagtatcctgtggatctttattatctggttgatgtctcagcatcgatgcacaat
aatattgaaaagttaaattctgttggaaatgatttatctaaaaaaatgtcatttttctcc
cgtgacttccgtcttggatttggctcatatgttgataaaacagtttcaccatacatcagc
atccacccagagaggattcataatcaatgcagtgactacaatttagactgtatgcctccc
catggatatatccatgtgctgtctttgacagaaaacatcactgagtttgaaaaggctgtt
cacagacagaagatctctggaaatatagacacaccagaaggaggtttcgatgctatgctt
caagcagctgtctgtgagagtcatattggatggcgaaaagaagctaaaagattgctgctg
gtgatgacagatcagacatctcatcttgctcttgatagcaaattggcaggcatagtggtg
ccaaatgacggaaactgccatctgaaaaacaacgtctacgtcagatcaacaagcatggaa
catccctcactaggccaactttcaaaaaagttaatagacaacaacattaatgtcatcttt
gcagttcaaggaaaacagtttcattggtataaggaccttctacccctcttgcctggcacc
attgctggcgaaatagaatccaaagctgcaaacctcaataatttggtagtagaagcctat
cagaaactaatatcagaagtgaaagttcaggtggaaaaccaggtaaaaggcatctactta
aacatcaccgccatctgtccaaatgggaccagaaagctaggcacagatggatgcggaaac
gtgacaagcaatgatgaagttcttttcaatgtaacagttacgatgagaaaatgtgatgtc
acaggaggaaaaagctatgcaataatcaaacctattggtttcaatgaaaccactaaaatt
catatacacagaaactgcagctgtcagtgtgatgacagcagaggacctaaaagaaagtgc
atagatgaaaattttctcgattccaagtgtttccagtgcgatgagaataaatgtcatttt
gatgaagatcaatttccttctgaaagttgcaagtcacacaaggatcaacctgtttgcagc
ggtcgaggagtttgtatttgcgggaaatgtttgtgtcacaaaattaagcttggaaaagta
tatggaaaatactgtgaaaaggatgacttttcttgtccatatcaccatggaaatctgtgt
gctgggcacggagagtgtgaagcaggcagatgccagtgcttcagtggctgggaaggcgat
cggtgccagtgcccatcaacatcagcccagcactgtatcaatccaaagggccaggtgtgt
agtggaagaggcacatgtgtatgtggcaggtgtgagtgcaccgatcccaggagcataggc
cgcttctgtgaacactgccccacgtgtcacacagcctgcaatgaaaactggaattgtgtg
caatgccttcaccctcacaatctgtctcaagctatacttgatcggtgcaaaacctcatgt
actttcatggaacagcattatgcggaccaaacatcagaatgtttctctaccccaagctac
ttgaggatatttttcatcattttcatagttacattcttgattgggttgcttaaagtcctt
atcattagacaggtgatattacaatggaatagtaataaaataaagtcctcagctgattac
agggtgtcggcctcaaaaaaggacaagttgattctgcaaagtgtttgcacaagagcagta
acctaccgacgtgagaaacctgaagaaataaaaatggatatcggcaaattaaatgctcac
gaaactttcaggtgcaacttctaa

DBGET integrated database retrieval system