KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499504
Entry
107499504         CDS       T06036                                 

Gene name
CDC20
Definition
(RefSeq) cell division cycle protein 20 homolog
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray05166  Human T-cell leukemia virus 1 infection
ray05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107499504 (CDC20)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107499504 (CDC20)
   04114 Oocyte meiosis
    107499504 (CDC20)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107499504 (CDC20)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107499504 (CDC20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107499504 (CDC20)
   03036 Chromosome and associated proteins [BR:ray03036]
    107499504 (CDC20)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     107499504 (CDC20)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107499504 (CDC20)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 ELYS-bb
Other DBs
NCBI-GeneID: 107499504
NCBI-ProteinID: XP_015979214
LinkDB
Position
Unknown
AA seq 499 aa
MAQFVFESDLHSLLQLDTPIPNVPPARWQRKAKEASGPAPSPMRSANRSHSAGRTPGRTP
GKSSSKVQTTPNKPGGDRYIPHRSASQMEVASFLLSKENHPENSQTPTKKEHQKAWALNL
NGFDVEEAKILRLSGKPQKVPEGYQNRLKVLYSQKATPGSTRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGDYVSSVSWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLCWNSYILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGESGWVPLQTFTQHQGAVKA
VAWCPWQSNILATGGGTSDRHIRIWNVCSGACLNAVDAHSQVCSILWSSHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTARVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASGAKSSLIHQGIR
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcgcagttcgtgttcgagagtgacctgcattcgctgctgcagctggacacacctatc
cccaatgtgccccccgcgcgctggcagcgcaaagctaaggaagcctcgggaccggcccct
tcacccatgcgttccgccaacagatcccacagcgctggcaggaccccgggccgaactccg
ggcaaatccagctccaaggttcagaccactcccaacaaacccgggggtgatcgctatatc
ccccatcgcagtgcctcacagatggaggtggccagcttcctcctgagcaaggagaaccac
cctgaaaacagccagacgcccaccaagaaggaacatcagaaagcctgggctttgaacctg
aatggttttgatgtggaagaagccaagatccttcggctcagtggaaaaccacagaaagtc
ccagaaggttaccagaatagactgaaagtactctatagtcagaaggccacgcctggctcc
acccggaagacatgccgttacattccttcccttccagaccgtatcttggacgcccctgaa
atccgtaatgactactacctgaatctggtggattggagctctgggaatgtactggctgtg
gcgttggacaacagtgtgtacttgtggagtgctagctctggtgacatcttgcagctcctg
cagatggagcagcctggggactatgtatcttctgtgtcctggatcaaagagggcaactac
ctggctgtgggcaccagcagtgctgaggtgcagctatgggatgtgcaacagcagaagcgt
cttcgaaacatgaccagtcattctgcccgagtgggttccttatgttggaatagctatatc
ttgtccagtggctcacgctctggccacattcaccaccatgatgttcgggtagcagagcac
catgtggccacattgagtggtcacagccaggaagtttgtgggctgcgctgggccccagat
ggacgacatttggccagtggtggcaatgataacttggttaacgtgtggcctagtgctcct
ggagaaagtggctgggttcctctgcagacattcacccagcatcaaggggctgttaaggct
gtggcttggtgtccctggcagtccaatatcttggcaactggagggggcactagtgatcga
cacattcgcatctggaacgtctgttctggggcctgtctgaatgctgtagatgcccactcc
caggtgtgctccatcctctggtcttcccactacaaggaactcatctcaggccatggcttt
gcccagaaccagctggttatttggaagtacccaaccatggccaaagtggctgagctcaaa
ggtcacacagcccgagttctaagtctgaccatgagtccagatggggccacagtggcatca
gcagcagcagatgagaccctacggctatggcgctgctttgagttggaccctgcacggcgg
cgggagcgggagaaggccagtggggccaaaagcagcctcatccatcaaggcatccgttga

DBGET integrated database retrieval system