KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499553
Entry
107499553         CDS       T06036                                 

Gene name
ADCYAP1R1
Definition
(RefSeq) pituitary adenylate cyclase-activating polypeptide type I receptor isoform X1
  KO
K04587  pituitary adenylate cyclase-activating polypeptide type I receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04713  Circadian entrainment
ray04911  Insulin secretion
ray04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107499553 (ADCYAP1R1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107499553 (ADCYAP1R1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107499553 (ADCYAP1R1)
   04924 Renin secretion
    107499553 (ADCYAP1R1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107499553 (ADCYAP1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107499553 (ADCYAP1R1)
G protein-coupled receptors [BR:ray04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    107499553 (ADCYAP1R1)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 107499553
NCBI-ProteinID: XP_015979326
LinkDB
Position
Unknown
AA seq 489 aa
MASIMQALLTALLLLPMTTAMHSDCMFRKEEAMCLEKIQKANDLMGFNDSSPGCPGMWDN
ITCWKPAHVGEIVLVSCPELFQILNPDQGEPGFMHSNSLDLSDMRVVSRNCTEDGWSEPF
PHYFDACGFDDYESETGDQNFYYLSVKSLYTVGYSTSLVTLTTAMVILCRFRKLHCTRNF
IHMNLFASFMLRAIAVFIKDWILYAEQSSDHCFISTVECKATMVFFHYCVVSNYFWLFVE
GLYLFTLLVETFFPERRYFCWYILIGWGTPTVCVFVWAMLRLYFDNTGCWDMNDNTALWW
VIKGPVVGSIMVNFGLFVGIIIILVQKLQSPDTGGNESSVYFSCVQKCYCKPQRAQQHSC
KMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVL
YCFLNGEVQAEIKRKWRSWKVNRYFAVDFKHRHPSLASSGVNGGTQLSILSKSSSQIRMS
GLPADNLAT
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccagcatcatgcaggccttgttgactgccctcctcctgctgcctatgaccaccgcc
atgcactctgactgcatgttcaggaaggaggaagccatgtgtctggagaagatccagaag
gcgaacgacctgatgggctttaacgactcctccccaggctgccccgggatgtgggacaac
atcacgtgctggaagcccgcccacgtgggcgagatcgtgctggtcagctgccccgagctc
ttccaaatcctcaatccagaccaaggggagcctggtttcatgcacagtaactccttagac
ctctcagacatgcgggtggtgagccgaaactgcacagaggacggctggtccgagccgttc
cctcattattttgatgcttgtgggtttgacgactatgaatctgagaccggggaccagaat
ttctactacttgtcggtgaagtccctgtacacggttggctacagcacgtccctcgtcacc
ctcaccactgccatggtcatcctgtgccgcttccggaagctgcattgcacccggaacttc
atccacatgaacctgtttgcgtcgttcatgctgagagccatcgccgtcttcatcaaagac
tggatcctctacgcggagcagagcagcgaccactgcttcatctccaccgtggaatgcaag
gccacgatggttttcttccactactgcgtcgtgtccaactacttctggctgttcgtcgag
ggcctgtacctcttcaccctgctggtggagaccttcttccccgagaggagatacttctgc
tggtacatcctcattggctgggggaccccaactgtgtgcgtgtttgtgtgggccatgctg
aggctctactttgataacacaggctgttgggatatgaatgacaacacggctctgtggtgg
gtgatcaaaggccccgtggttggttccataatggtgaacttcgggctcttcgtgggcatc
atcatcatcctcgtgcagaaactccagtctccggacacgggaggcaacgagtccagcgtc
tacttcagctgcgtgcagaaatgctactgcaagccacagcgggctcagcagcactcttgc
aagatgtcagagctgtccaccattactctacggctggcccggtccaccctgctgctcatc
ccgctgttcgggatccactacacggtgttcgccttctccccggagaacgtcagcaagagg
gagaggctcgtgttcgagctggggctgggctccttccagggctttgtggtggccgttctc
tactgttttctgaatggagaggtgcaggccgagatcaagcgcaagtggcggagctggaag
gtgaaccgctacttcgccgtggacttcaagcaccggcacccatccctggccagcagcggg
gtgaacgggggcacccagctctccatcctgagcaagagcagctcccagattcgcatgtcc
ggcctcccggcggacaacctggccacctga

DBGET integrated database retrieval system