KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499557
Entry
107499557         CDS       T06036                                 

Gene name
AQP1
Definition
(RefSeq) aquaporin-1
  KO
K09864  aquaporin-1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04924  Renin secretion
ray04964  Proximal tubule bicarbonate reclamation
ray04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    107499557 (AQP1)
  09154 Digestive system
   04976 Bile secretion
    107499557 (AQP1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    107499557 (AQP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107499557 (AQP1)
   04147 Exosome [BR:ray04147]
    107499557 (AQP1)
Transporters [BR:ray02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    107499557 (AQP1)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107499557 (AQP1)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 107499557
NCBI-ProteinID: XP_015979337
UniProt: A0A7J8D3V9
LinkDB
Position
Unknown
AA seq 271 aa
MASEFKKKLFWRAVAAEFLAMTLFVFISIGSALGFNYPLKNNQTSGAMQDNVKVSLAFGL
SIATLAQSVGHISGAHLNPAVTLGLLLSCQISILRAITYMVAQCVGAIVATAILSGITSS
LSDNSLGRNALASGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGFSVAL
GHLLAIDYTGCGINPARSFGSAVITHNFRDHWIFWVGPFIGAALAVLIYDFILAPRCSDV
TDRMKVWTSGQVEEYDLDAEDINSRVEMKPK
NT seq 816 nt   +upstreamnt  +downstreamnt
atggccagcgagttcaagaagaagctcttctggagggcagtggcggccgagttcctggcc
atgaccctgttcgtcttcatcagcattggttccgccctgggcttcaactaccccctgaag
aacaaccagacgtcgggtgcgatgcaagacaacgtgaaggtgtccctggcgttcgggctg
agcattgccacgctggcccagagcgtgggccacatcagcggcgcccacctcaacccggcc
gtcacgctggggctgctgctcagctgtcagatcagcatcctccgggccatcacgtacatg
gtggcccagtgcgtgggggccatcgtcgccaccgccatcctctcgggcatcacctcctcc
ctgagcgacaactcgctcggccgcaacgcgctggcctccggcgtgaactcaggccagggc
ctgggcatcgagatcatcggcaccctgcagctggtgctgtgcgtgctggccaccaccgat
cggaggcgccgcgacctcgggggctcggcaccccttgccataggcttctccgtggccctg
ggacacctgctggccatcgactacactggctgtggtattaaccctgcccggtccttcggc
tcggcggtgatcacccacaacttcagggaccactggatcttctgggtggggccgttcatc
ggcgcagccctggccgtgctcatctacgacttcatcctggcccctcgctgcagcgacgtc
acggaccgcatgaaggtgtggaccagcggccaggtggaggagtacgacctggatgctgag
gacatcaactccagggtggaaatgaagcccaaatag

DBGET integrated database retrieval system