KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499568
Entry
107499568         CDS       T06036                                 

Gene name
DYNC1I2
Definition
(RefSeq) cytoplasmic dynein 1 intermediate chain 2 isoform X1
  KO
K10415  dynein intermediate chain, cytosolic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04962  Vasopressin-regulated water reabsorption
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107499568 (DYNC1I2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107499568 (DYNC1I2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107499568 (DYNC1I2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107499568 (DYNC1I2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107499568 (DYNC1I2)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107499568 (DYNC1I2)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107499568 (DYNC1I2)
SSDB
Motif
Pfam: Dynein_IC2 WD40 ANAPC4_WD40 Glyco_transf_5
Other DBs
NCBI-GeneID: 107499568
NCBI-ProteinID: XP_015979357
LinkDB
Position
Unknown
AA seq 632 aa
MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEESDLEKKRREA
EALLQSMGLTPESPIVPPPMSPSSKSVSTPSEAGSQDSGDGAVGSRTLHWDTDPSVLQLH
SDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEEDDVVTPKPPTE
PEEEKTLKKDEENDSKAPPHELTEEEKQQILHCEEFLSFFDHSTRIVERALSEQINIFFD
YSGRDLEDKEGEIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPELLVASYNNNEDAP
HEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNK
RTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVH
KQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQGPITGIHCHA
AVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGM
GRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSEGQIVIYDVGEQIAVP
RNDEWARFGRTLAEINANRADAEEEAATRIPA
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgtcggacaaaagtgaattaaaggcagagttggaacggaagaagcagcggttggcccaa
atcagagaggagaagaagagaaaagaagaagaaaggaaaaaaaaggaaactgatcagaag
aaagaagcagttgctcctgtgcaggaagaatcagatcttgaaaaaaaaagaagagaagct
gaagcactacttcaaagcatggggctaactccagaatcccccattgtccctcctcctatg
tctccatcctccaaatctgtgagcacaccaagtgaagctgggagccaagactctggagac
ggtgcagtgggatctaggacgctgcattgggatacagatccatcagttcttcagcttcac
tcagattccgatttgggacgaggacctattaaacttggaatggctaaaattacacaagtt
gactttcctcctcgagaaattgtgacatatacaaaggaaactcagactccagttatggct
caacccaaagaagatgaagaggaagaagacgatgtggtgactcctaaaccacctactgaa
cctgaagaagagaaaactttaaagaaagatgaagaaaatgacagtaaagctccccctcat
gagctgactgaagaagaaaagcaacaaatcttgcactgcgaagaatttttaagtttcttt
gaccattctacaagaattgtagaaagggctctttctgagcagataaacatcttctttgac
tacagtggaagagatttggaagacaaagaaggagagattcaagcaggtgctaaactgtca
ttaaatcgacaattttttgatgaacgttggtcaaagcatcgggttgttagttgtttggat
tggtcatctcagtatccagagttactcgtggcttcatataataacaatgaagatgctcct
catgagcctgatggtgtggcccttgtatggaatatgaagtacaaaaaaactaccccagag
tatgtgtttcactgccagtcagctgtgatgtctgctacatttgcaaaatttcacccaaat
ttggttgtcggtggtacgtattcaggccaaattgtgctgtgggataaccgtagcaataaa
agaactccagtgcaaagaactccactgtcagctgctgcacacacacatcctgtatattgt
gtaaatgtcgttggaacgcaaaatgctcataatctgattagcatctctactgatggaaaa
atttgttcatggagtctggatatgctttcccatccacaggatagcatggaattggttcat
aaacagtcaaaggcagtagctgtgacatctatgtccttccctgttggagatgtcaacaac
tttgttgttgggagtgaagaaggttctgtgtacacagcatgtcgccatggcagcaaagct
ggaatcagtgagatgttcgagggacaccaaggaccaatcactggcatccattgtcatgca
gctgttggagcagtagacttctcacatctttttgtcacttcatcatttgactggacagta
aaactttggacaactaagaataacaagcctttatactcatttgaagataattcagactac
gtttatgatgttatgtggtcacccacccacccagccctctttgcctgtgtggatggcatg
gggaggctagatttgtggaatctcaataatgacacggaggtgccaactgccagcatttct
gtggagggtaatcctgctcttaatcgtgtaagatggacccattctggaagagagattgcc
gtgggtgattctgaaggacagattgttatatatgatgtgggagagcagatcgctgtcccc
cgaaatgatgaatgggcacggtttggccgaacacttgcagaaattaatgcaaatcgagct
gatgcagaggaggaggctgctacccgaatacctgcgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501252
Entry
107501252         CDS       T06036                                 

Gene name
DYNLL1
Definition
(RefSeq) dynein light chain 1, cytoplasmic
  KO
K10418  dynein light chain LC8-type
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04962  Vasopressin-regulated water reabsorption
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107501252 (DYNLL1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107501252 (DYNLL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107501252 (DYNLL1)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107501252 (DYNLL1)
SSDB
Motif
Pfam: Dynein_light
Other DBs
NCBI-GeneID: 107501252
NCBI-ProteinID: XP_015982698
LinkDB
Position
Unknown
AA seq 89 aa
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtgcgaccgaaaggcagtgatcaaaaatgcagatatgtcggaggagatgcaacaggac
tcggtggagtgtgccactcaggcgttggagaaatacaatatagagaaggacattgcggct
catattaagaaggagtttgacaagaagtacaaccccacctggcactgcatcgtggggagg
aacttcggtagttacgtgacacatgaaaccaaacacttcatctacttctacctgggccaa
gtggccattcttctgttcaaatctggttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503033
Entry
107503033         CDS       T06036                                 

Gene name
DYNLL2
Definition
(RefSeq) dynein light chain 2, cytoplasmic
  KO
K10418  dynein light chain LC8-type
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04962  Vasopressin-regulated water reabsorption
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107503033 (DYNLL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107503033 (DYNLL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107503033 (DYNLL2)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107503033 (DYNLL2)
SSDB
Motif
Pfam: Dynein_light Nop Ectatomin
Other DBs
NCBI-GeneID: 107503033
NCBI-ProteinID: XP_015986344
LinkDB
Position
Unknown
AA seq 89 aa
MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
NT seq 270 nt   +upstreamnt  +downstreamnt
atgtctgaccggaaggcagtgatcaagaacgcagacatgtctgaggacatgcaacaggat
gccgttgactgtgctactcaggctatggagaagtacaacatagagaaggacattgctgcg
tatatcaagaaggaatttgacaagaaatataaccctacctggcattgtatcgtgggccga
aattttggcagctacgttacacacgagacaaagcacttcatctatttttacttgggtcaa
gttgcaattctcctcttcaagtcaggctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503329
Entry
107503329         CDS       T06036                                 

Gene name
DYNC1I1
Definition
(RefSeq) cytoplasmic dynein 1 intermediate chain 1 isoform X1
  KO
K10415  dynein intermediate chain, cytosolic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04962  Vasopressin-regulated water reabsorption
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107503329 (DYNC1I1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107503329 (DYNC1I1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107503329 (DYNC1I1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107503329 (DYNC1I1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107503329 (DYNC1I1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107503329 (DYNC1I1)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107503329 (DYNC1I1)
SSDB
Motif
Pfam: Dynein_IC2 WD40
Other DBs
NCBI-GeneID: 107503329
NCBI-ProteinID: XP_015986940
LinkDB
Position
Unknown
AA seq 691 aa
MVHSHRQCKIVEKHCSAKVRSERRQRRARSEEILEPGCRSPRSQMLQGTRARDGTLITSQ
ETNMSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRR
ETEALLQSIGISPEPPLVPTPMSPSSKSASTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQ
LQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVEPKTG
HDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFD
YSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYPELMVASYNNNEDAP
HEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHR
RTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSLDMLSTPQESMELVY
NKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGINCHM
AVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGM
GRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEGRIWVYDVGELAVPH
NDEWTRFARTLVEIRANRADSEEEGTVELSA
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggtgcactcacacaggcagtgtaaaatagttgagaaacattgctctgcaaaagtaaga
agtgagagaaggcagcgacgtgctagatcagaggaaatcttggagccaggatgcaggagt
cccagaagccaaatgctgcaagggacaagggcacgagatgggaccctgatcacttctcag
gaaaccaacatgtctgacaaaagtgacttaaaagctgagctagagcgcaagaaacagcgc
ttagcacagataagagaagagaagaaacggaaggaagaggagaggaaaaagaaagaggct
gacatgcagcagaagaaggaacctgttcaggacgactccgacctggatcgcaagcgtcgg
gagacagaggccctgctgcagagcatcggcatatcgcccgagcccccgctagtcccaacc
cctatgtctccctcctcgaaatcagcgagcactcccagtgaagctggaagccaagactca
ggcgacctgggaccattaacaaggaccctgcagtgggacacagacccctcagtgctccag
ctgcagtcagactcagaacttggacgaagactacataagctgggtgtatcgaaggttacc
caagtggacttcctgcccagggaagtggtgtcttactccaaggagacccagactcctctg
gccacacatcagtctgaagaggatgaggaagatgaagaaatggtggaacctaaaactggc
catgattcagaactggaaaatcaagacaaaaaacaggaggtgaaggaagcacctccaagg
gagctgacggaggaagaaaaacagcagatccttcattcagaggaatttctcatcttcttt
gatcggaccatacgggtaatcgaaagagcactggcagaagactctgacatcttctttgac
tatagcggtcgagagttagaggaaaaagatggggatgtccaggctggagccaacctttct
ttcaatcgtcagttctatgatgaacattggtccaagcatcgagtagtcacttgtatggac
tggtcactccagtaccccgagctgatggtcgcttcctacaacaacaatgaagatgctccc
catgaaccagatggagtggccttggtttggaacatgaagtttaagaaaaccacaccagaa
tacgtcttccactgtcagtcctctgtgatgtcagtctgctttgctcgttttcatcccaac
ttggtagttggtgggacttactcaggccagattgtcctgtgggataatcgcagtcaccgg
aggacgccagtgcagcggacacccttgtcagctgctgcacacacacatcccgtgtactgt
gtaaatgttgtagggacccagaatgctcataacctcatcaccgtctctactgatggtaaa
atgtgttcctggagcctggacatgctctcaactccacaggagagcatggagctggtgtac
aataagtccaagcctgtagctgttacgggaatggctttcccaacgggagacgtcaataac
ttcgtggttggcagtgaggagggtacggtctacacggcctgtcgtcatggaagcaaagca
ggtattggtgaggtcttcgaaggtcaccaagggccagtgacgggaattaactgccacatg
gcagtgggcccaatcgacttttcacacctgtttgtcacatcatcatttgactggaccgtc
aaactgtggactacaaagcacaacaagccgctctactcctttgaagacaatgcagactat
gtgtacgatgtcatgtggtcccccgtgcatcccgcgctctttgcctgcgtggacgggatg
gggcgattggacctctggaacctcaacaatgacaccgaggttccaacagcaagtgtggcc
atcgagggggcgtctgccctcaaccgtgtgcgttgggctcaagctggcaaagaagttgct
gttggagactcagaaggccgtatttgggtctacgacgttggagagcttgcagtaccccac
aatgatgagtggacccgatttgccaggaccctcgtggagattcgtgctaatagagctgat
agcgaggaggaaggcaccgtggagttatctgcctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508781
Entry
107508781         CDS       T06036                                 

Gene name
DYNC1LI1
Definition
(RefSeq) cytoplasmic dynein 1 light intermediate chain 1
  KO
K10416  dynein light intermediate chain 1, cytosolic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04962  Vasopressin-regulated water reabsorption
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107508781 (DYNC1LI1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107508781 (DYNC1LI1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107508781 (DYNC1LI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107508781 (DYNC1LI1)
   03036 Chromosome and associated proteins [BR:ray03036]
    107508781 (DYNC1LI1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107508781 (DYNC1LI1)
Membrane trafficking [BR:ray04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    107508781 (DYNC1LI1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107508781 (DYNC1LI1)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107508781 (DYNC1LI1)
SSDB
Motif
Pfam: DLIC ABC_tran Roc RsgA_GTPase AAA_16 PduV-EutP DUF815 G-alpha TsaE AAA_7
Other DBs
NCBI-GeneID: 107508781
NCBI-ProteinID: XP_015996244
LinkDB
Position
Unknown
AA seq 524 aa
MAAVGRVSSFGSSPPGLVSTYTGGPLANELTSGNGGAAAGDDEDGQNLWSCILSEVSTRS
RSKLPAGKNVLLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVW
ILDGDLYHKGLLKFSLDAGSLKDTLVMLVVDMSKPWTALDSLQKWASVVREHIDKLKIPP
EEMKEMEQKLIRDFQEYVEPGEDFPASPQRRNTVSQEDKDDSVVLPLGADTLTHNLGIPV
LVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGAALIYTSVKENKNTDLVYKYI
VQKLYGFPYKIPAVIVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFEDIITKPPVRK
FVHEKEIVAEDDQVFLMKLQSLLAKQPPTTAGRPVDASPRVPGGSPRTPNRSVSSNVASV
SPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVGGGSPGGGAGGGSSGL
PPSAKKSGQKPVLSDVHAELDRITRKPVTVSPTTPTSPTEGEAS
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggcggctgtggggcgagtcagctccttcggctcctctccgccgggattagtttcgact
tacactggcggccccttggccaacgagctaacgtcgggcaacggcggcgctgcagcaggc
gacgacgaggacgggcagaacctttggtcctgcatcctcagtgaggtctccacccgctcg
cgctccaagctccccgcggggaagaacgtactgctgttgggtgaagatggagctgggaaa
acaagcttaatcagaaaaattcagggaatagaggagtacaagaaaggaagaggattggaa
tatttgtacttaaatgttcacgatgaagacagggatgatcaaacaagatgtaatgtttgg
atattagatggagatctatatcacaaaggcctccttaaattttcgctggatgctggttct
ctgaaggacactctagttatgctggttgttgatatgtcaaagccttggactgctttggat
tctttacagaaatgggcaagcgttgttagggaacatattgacaaattgaaaattcctcct
gaagaaatgaaagaaatggaacaaaagctgattagagacttccaagaatatgtagagcca
ggagaagatttcccagcttctcctcagagaagaaatactgtatcacaggaagacaaagac
gacagtgtggttctgcctctgggcgcagatacacttacacacaacttgggcattccagta
ctagtagtttgcacgaagtgtgatgccattagtgtattggagaaagaacatgactacaga
gatgaacattttgattttattcagtcacatatccggaagttttgtttacagtatggtgca
gcacttatttacacttcagtaaaagaaaacaaaaatacagatttagtatataaatacatt
gttcagaaactatatggattcccgtataagattcctgctgttattgtggaaaaagatgca
gtatttattccagcagggtgggataatgataagaaaataggaatattacatgaaaatttt
caaactttaaaagcagaagataattttgaagacattataactaaaccacctgtccgaaag
tttgtccatgagaaggaaattgtggcagaagatgaccaagtatttcttatgaagctacag
tcccttttagcaaaacaaccaccaactacagctggaaggcctgtggatgcctcaccaaga
gtcccaggaggttcccctcgaacaccaaacagatctgtgtcatccaatgttgccagcgtg
tcacccatccctgcagggtcgaaaaaaattgatccaaacatgaaagctggagctacaagt
gaaggtgtcctggcaaatttcttcaacagtttgctgagtaaaaagactggttctccagga
ggccctggcgttggtggtggtagccctggaggtggggctggaggtggaagcagtggttta
ccaccatctgccaagaagtcaggccagaagcctgtcctatcagatgttcacgcggaacta
gacagaattacacgaaaaccagttacagtttctcctacaacacctacgtctcctacagaa
ggagaagcttcttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509581
Entry
107509581         CDS       T06036                                 

Gene name
DYNC2LI1
Definition
(RefSeq) cytoplasmic dynein 2 light intermediate chain 1 isoform X1
  KO
K10417  dynein light intermediate chain 2, cytosolic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04962  Vasopressin-regulated water reabsorption
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107509581 (DYNC2LI1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107509581 (DYNC2LI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107509581 (DYNC2LI1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107509581 (DYNC2LI1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107509581 (DYNC2LI1)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107509581 (DYNC2LI1)
SSDB
Motif
Pfam: DLIC Roc HELP
Other DBs
NCBI-GeneID: 107509581
NCBI-ProteinID: XP_015997710
LinkDB
Position
Unknown
AA seq 351 aa
MPSETLWEIAKAEVEKRGNNGNEGDGVETGEKSVFFIGSKNGGKTTIILRCLDRDEPPKP
TLALEYTYGRRAKGHNIPKDIAHFWELGGGTSLLDLISIPITSDTLRTFSIVLVLDLSKP
NDLWPTMENLLQATKSHVDKVIMKLGKTNSKAASEMRQKIWSNMQKDHQDRELIDPFPIP
LVIIGSKYDIFQDFDSEKRKVICKTLRFVAHYYGASLMFTSKSEALLLKIRGVINQLAFG
IDKSKSICVDQNKPLFITAGLDSLSHIGSPPVPDNDIGKLHAHSPMELWKKVYAKLFPPK
TVNTLKDIKDPAKDPQYAESEVDEMRIQKDQELEQYKRSSSKSWKQIELDS
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgcccagtgaaactctctgggaaattgcaaaagccgaagtagaaaaacgaggaaataat
ggaaatgaaggtgatggagttgaaactggagaaaaatctgttttcttcattggcagtaaa
aatgggggaaaaactactattatcctaaggtgtcttgacagggatgagccaccaaaacca
accttagctttggaatatacgtatggaagaagagcgaaagggcataatataccaaaagat
attgctcacttttgggaactaggtggaggaacctctttattggacttaatcagcatacca
atcacaagtgataccttaaggacattttccattgttcttgttttggatctttcaaaacct
aatgacctttggcccaccatggaaaatctgttgcaagccacaaaaagccatgtggataaa
gtgataatgaaactgggaaagacaaattctaaagcagcttctgaaatgagacagaagata
tggagtaatatgcaaaaggaccatcaagatcgtgaattaattgacccatttccaatacct
ctggtcataattggaagtaaatacgatatttttcaggattttgactccgagaagagaaag
gtaatatgcaagacacttcgatttgttgcacattattatggagcatcattaatgtttacc
agtaaatcagaagctttattactaaaaatacgtggagttatcaaccagttggcttttggt
attgacaaaagcaaatcaatatgtgtggatcagaataaaccactgtttatcacagcagga
ttggattctttaagtcatataggatctcctcctgttcctgataatgacattggaaagctt
catgcccattcaccaatggagttgtggaaaaaagtgtatgcaaagctctttccaccaaag
actgtcaacacactaaaagatatcaaggaccctgcaaaagaccctcagtatgctgaaagt
gaagttgatgaaatgagaattcaaaaggatcaggaactggaacagtacaaaagaagttct
tccaagtcttggaaacaaattgagctggattcttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519818
Entry
107519818         CDS       T06036                                 

Gene name
DYNC1LI2
Definition
(RefSeq) cytoplasmic dynein 1 light intermediate chain 2 isoform X1
  KO
K10416  dynein light intermediate chain 1, cytosolic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04962  Vasopressin-regulated water reabsorption
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107519818 (DYNC1LI2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107519818 (DYNC1LI2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107519818 (DYNC1LI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107519818 (DYNC1LI2)
   03036 Chromosome and associated proteins [BR:ray03036]
    107519818 (DYNC1LI2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107519818 (DYNC1LI2)
Membrane trafficking [BR:ray04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    107519818 (DYNC1LI2)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107519818 (DYNC1LI2)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107519818 (DYNC1LI2)
SSDB
Motif
Pfam: DLIC ABC_tran AAA_22 AAA_16 AAA_7 Arf PduV-EutP Roc AAA_24 AAA_29 NACHT ATPase G-alpha AAA_25
Other DBs
NCBI-GeneID: 107519818
NCBI-ProteinID: XP_016018362
LinkDB
Position
Unknown
AA seq 496 aa
MAPVGVEKKVLLGPNGPAVAAASDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVF
GEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLK
FAVSAESLPETLVIFVADMSRPWTMMESVQKWASVLREHIDKMKIPPEEMRELERKFVKD
FQDYIEPEEGCQGSPQRRGPLTSGPDEENVALPLGDNVLTHNLGIPVLVVCTKCDAVSVL
EKEHDYREEHFDFIQSHLRRFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTTPA
LVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIMKPPVRKVPKSLVHDKEVAA
EDEQVFLMKQQSLLAKQPATPTRASESPARGPSGSPRTQGRGGPASVPSASPGTSVKKPD
PNIKNNAASEGVLASFFNSLLSKKTGSPGSPGAGGVQSTAKKSGQKTVLTNVQEELDRMT
RKPDSMVTNSSTENEA
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggcgccggtgggggtggagaagaaagtgctgctaggccccaacgggcccgccgtggcg
gccgccagtgacctgaccagcgaggaggaggagggccaaagcctatggtcctcgattctg
agtgaggtgtccacccgcgccaggtccaagctgccgtccggcaagaatattctggttttc
ggtgaagatggttctggtaaaacaaccctcatgactaaactacaaggagctgagcatggc
aaaaaaggaagaggcctagagtatctctacctcagcgtccatgacgaggaccgagatgat
cacacacgttgtaacgtgtggattcttgatggagacctgtaccacaaaggcctgctgaag
tttgcagtttctgctgaatccttgccggagaccctggtcatttttgttgcagacatgtct
aggccttggactatgatggaatctgtacagaaatgggctagtgttttacgtgagcacatt
gataaaatgaaaattccaccagaagaaatgagggagctggaacggaagtttgtgaaagat
tttcaagactatattgaacctgaagaaggttgtcaaggttccccacaaagaagagggcct
ctgacttcgggtcctgatgaagaaaatgttgccctgcctctcggtgacaacgtgctgact
cataacctcgggatccccgtgttggtggtgtgcacaaagtgtgatgcggtgagtgtcctg
gagaaggagcatgattacagggaggagcactttgacttcatccagtcacacctacggagg
ttctgcctccagtatggagctgcgttgatttacacatcagtgaaggaagagaagaacctc
gacttgttgtataagtacattgttcataaaacatatggtttccactttaccacacctgcc
ttagttgtggaaaaggatgcagtttttatacctgcaggctgggacaatgaaaagaaaata
gcaattttacatgaaaatttcacaactgtgaagccagaagatgcatatgaagactttatc
atgaaacctcctgtgagaaaggtacccaagtcactggtccacgacaaagaggtggctgca
gaggatgagcaggtgttcctaatgaagcaacagtcactccttgccaagcagccagccacg
cccacgagagcttccgaatctcctgcgagaggaccctctggctctccaagaacccagggc
cggggagggccagccagcgtgcctagtgcctccccaggcacatcagtaaagaagccggac
ccaaacatcaaaaataatgcagcaagtgaaggggtattggccagcttcttcaacagtctg
ttgagtaaaaaaacaggctctcctggaagccctggtgccggtggggtacagagcacagcc
aagaagtcaggacaaaagactgtgttgacaaatgttcaggaagaactggatagaatgact
cgaaaaccagactccatggtaacaaactcttcaacagaaaatgaagcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520205
Entry
107520205         CDS       T06036                                 

Gene name
DYNC2H1
Definition
(RefSeq) cytoplasmic dynein 2 heavy chain 1 isoform X1
  KO
K10414  dynein heavy chain 2, cytosolic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04962  Vasopressin-regulated water reabsorption
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107520205 (DYNC2H1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107520205 (DYNC2H1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107520205 (DYNC2H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107520205 (DYNC2H1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107520205 (DYNC2H1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107520205 (DYNC2H1)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107520205 (DYNC2H1)
SSDB
Motif
Pfam: AAA_6 DHC_N2 AAA_9 AAA_8 Dynein_C AAA_lid_11 AAA_5 DHC_N1 Dynein_heavy MT AAA_7 AAA_22 AAA_16 RsgA_GTPase AAA ABC_tran AAA_24 AAA_18 AAA_30 RNA_helicase AAA_28 AAA_29 ATPase_2 AAA_33 ERM AAA_23
Other DBs
NCBI-GeneID: 107520205
NCBI-ProteinID: XP_016019159
LinkDB
Position
Unknown
AA seq 4314 aa
MAGGVGDVRKLFIFSTTENYFGLVSEPLDQTLLYNSPEINNFLDDGNQMLLRVQRSDTGI
SFSNTIDFADTKDKVLVFFKLRPEVITDQNLHNNILVSSMLESPINSLYQAVRQIFAPML
LKDQEWSRNFDPKLQNLLSELESGLGIVLRRSDTNLSKLKFKEDDTRGILTPNDEFQFWT
EQAHRGSKQISKERASYFKELFETIAREFYNLDSLSLLEVVDLVETTRDVVDDVWRQTEH
DHYPESRMLHLLDIIGGSFGRFVQKKLGTLNLWEDSYYLVKENLKAGISICEQWVIACNH
LTGQVWQRYVPHPWKNEKYFPETLDKLGKRLEEVLAIRTIHEKLVYFLPAGEEKITCLAR
VFEPFTGLNPVQYNPYTEPLWKAAVSQYEKIIAPAEKKIAGKLKNYISEIQDSPQQLLQA
FLKYKELVKRPTISKELMLERETLLARLVDSVKDFRLDFENRCRGIPGDASGPLSGKNLS
EVVNNIVWVRQLELKVDDTIKIAEALLSDLSGFRSFHRSAEDLLDQFKLYEQEQFDDWSR
DIQSGLSDSRSGLCIEANSRIMELDPNDGSLKVHYSDRLVILLREVRQLSALGFVIPAKI
QQVANIAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGEK
SQITWDNPKELEGYIQKLQNAAERLATENRKLRKWHTTFCEKVVILMNIDLLRQQQRWKD
GLQELRTGLASVEAQGFQASDMHAWKQHWNHQLYKALEHQYQMGLEALNENLPEINIDLT
YKQGRLHFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEAGDESIFSIMIDRNASGFLTIF
SKAEDLFRRLSAVLQQHKEWIVIGQVDMEALVEKHLSTVHDWEKNFKALKIKGKEVERLP
SSVKVDCLNINCSPVKTVIDDLIQKLFDMLVLSLKKSIQALLHEIDTFVTEAMAVLSIMP
QSVEEIGDANLQYSKLQERKPEILPLFQEAEDKNRLLRTVAGRGLETISNLKAKWDKFEL
MMESHQLMIKDQIEVMKGNVKSRLQIYYQELEKFKARWDQLKPSDDVIEAGQQNTLDKSA
KSIKEKKIEFDDLEAIRKKLVDDCHHFGLEEPNFSLACSISKDIESCVQIWTLYEEFQQG
FQEMANEDWITFRTKTYLFEEFLMSWHDRLRKVEEHSVMTVKLQSEVDKYKIAVPILKYV
RGEHLSPDHWLDLFRLLGLPRGTSLEKLVFGDLLRVADTIVAKASDLKDLNSRAQGEVTI
REALRELDLWGVGAVFTLIDYEDSQSRTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKG
FEDKVSIWERKLAELDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNRVDEDFRSIMT
DIKRDNRVTTLTTHAGIRNSLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEI
LGQSTNPSVIQSHLKKLFAGINSVCFDEESKHITAMKSLEGEVVPFKNKVLLSNNVETWL
NDLALEMKQTLKQLLTECVTTGQSSQGAVDPSLFPSQILCLAEQIKFTEDVENAIQDHSL
HQIETQLVNKLEHYTNIDTSSEDPGNTESGILELKLKALILDIIHNIDVVKQLNQVQVHT
TEDWAWKKQVRFYMKSDHTCYVQMVDSELQYTYEYQGNAPKLVYTPLTDKCYLTLTQAMK
MGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCF
DEFNRLEESVLSAVSMQIQTIQDALKNHRTICELLGKEVEINSNSGIFITMNPAGKGYGG
RQKLPDNLKQLFRPVAMSRPDNELIAEVILYSEGFKDAKVLGRKLVAIFNLSRELLTPQQ
HYDWGLRALKTVLRGSGNLLRQLKKTGIKQKVNESHIVVQALRLNTMSKFTFVDCTRFDA
LIKDVFPGIDFKEVEYDELSAALKQVFEEANYEIIPNQIKKALELYEQLRQRMGVVIVGP
SGAGKSTLWRMLRAALCKIGQIVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQ
VVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLS
CASPATISRMGMIFLSDEETDLNSLIKSWLRNQPPKYRNNLENWIGNYFEKALQWVLKQN
DYVVETSLVGTVMNGLSHLHGCKDHDQFIINLIRGLGGNLNMKSRLEFTKEVFNWARESP
PDSHKPMDTYYDSSRGRLASYVLKKPENLTANDFSNGQTLPVIQTPDMQRGLDYFKPWLS
SDTQQPFILVGPEGCGKGMLLRYAFSQLRSTQIATVHCSAQTTSRHLLQKLSQTCMVIST
NTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENI
QIVASMSAGGRVGRHKLTTRFTSVVRLCAIDYPEREQLQTIYGAYLEPVLHKNLKNHSIW
GSSSKINLLAGSMVQVYEQVRAKFTVDDYSHYFFTPCILTQWVLGLFRYDLEGGSSKHPL
DYVLEIVAYEARRLFRDKIVGAKELHLFDSILISVFQGDWGSDILDNMADSFYVTWGARH
DSATRTAPVQSLPPHGKPLGKLNSADLKDVIKKGLIHYGRDNQNLDILLFQEVLEYVSRI
DRVLSFPGGSLLLAGRSGVGRRTITSLVSHMHGAVLFSPKISRGYELKQFKNDLKHVLHL
AGIEAQQVVLLLEDYQFVHPTFLEMINSLLSSGEVPGLYTLEELEPLLLPLKDQASQDGF
FGPVFNYFTYRIQQNLHIVLIMDSANLNFIINCESNPALHKKCQVLWMEGWSDSSMKKIP
EMLFNETGSEEKCSDKKGKEEKKKNSVDPDFLKSFLLIHESCKAYGATPSRYMTFLHVYS
AISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSVLLKTKQDEADAALQEIT
VSMQDASEQKTELERLKHKIAEEVVKIEERKNKIDDELKEVQPLVNEAKLAVGNIKPESL
SEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNIPKEIR
ESVEELLFKNKGSFDPKNAKRASTAAAPLAAWVKANVQYSHVLERIQPLETEQAGLESNL
KKTEDRKRKLEELLNSVGQKVSELKEKFQSRTSEAAKLESEVSKAQETIKAAEVLINQLD
REHKRWNTQVAEITEELATLPKRAQLAAAFITYLSAAPEGLRKTCLEEWSKSACLEKFDL
RRFLCTESEQLIWKSEGLPSDDLSIENAIVILQIIGLKSWSRVCPFLIDPSSQATEWLKT
HLKDSRLEVINQQDNNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQGPRFVV
QIGDKIIDYNEEFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKP
DLEEQKTKLLQQEEDKKIQLAKLEESLLETLATSQGNILENKDLIESLNQTKASSALIQE
SLKESYKLQIFLDQERDAYLPLAESASKMYFIISDLSKINNMYRFSLAAFLRLFQRALQN
KQDSENTEQRIQSLISSLKHMVYEYICRCLFKADQLMFALHFVRGMHPELFQENEWDTFT
GVVVGDMLRKADSQQRIRDQLPSWIDQERSWAVATLKIALPSLFQTLCFEDVALWRTFYH
NSMCEQEFPSILAKKVSLFQQVLVVQALRPDRLQSAMALFACKTLGLKELSPLPLNLKRL
YKETLEIEPILIIISPGADPSQELQELANAERSGECYHQVAMGQGQADLAVQMLKECARN
GDWLCLKNLHLVVSWLPVLEKELNTLQPKDTFRLWLTAEVHPNFTPILLQSSLKITYESP
PGLKKNLMRTYESWTPEQISKKDNIHRAHALFSFAWFHAACQERRNYIPQGWTKFYEFSL
SDLRAGYNVIDRLFDGTKDIQWEFVHGLLENAIYGGRIDNYFDLRVLQSYLKQFFNSSAI
DVLNQRNKKSLFPFSLSLPKSCSILDYRAIIEKLPEDDKPIFFGLPANIARSSQRMISSQ
VISQLRILGRSVTAGCKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVSPPNDRQGSPIL
SFIVLEQFNAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLTWQSKWEG
PEDPLQYLRGLVARALAIQSWVERAEKQALLSDTLDLSELFHPDTFLNALRQETARAMNC
SVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNRLSENQHDSPSVSSVLPCFMGWI
PQGAYGPYSPEESISLPVYTSAERDRVVTNIDVPCGGNQDQWIQCGAALFLKNQ
NT seq 12945 nt   +upstreamnt  +downstreamnt
atggcgggtggagtcggggacgttcggaagcttttcatcttcagtaccaccgagaattac
tttggactagtgtcggaacccttggaccagacgttgctgtataacagtcctgaaatcaac
aacttcttggatgacgggaatcagatgctcctaagggtgcagcgatccgacaccgggatc
tccttttccaacacgattgattttgctgacacaaaagataaagtgctggtgtttttcaag
ctgcgacctgaagtaattactgatcagaatctacataataacattcttgtttcatccatg
ttagaatcacctataaattccctttatcaagcggtacggcaaatatttgcgccaatgttg
ttaaaggatcaggaatggagcagaaactttgatcccaaacttcagaatcttttgagtgaa
ttagaatctgggttggggatagttctacgaagatcagacactaacttatcaaagttgaaa
tttaaggaagatgacacacgaggtattcttacaccaaatgatgagttccagttttggaca
gagcaagctcatcgtggaagtaaacagattagtaaagagagagccagttattttaaagaa
ttatttgaaacaattgcaagagagttttataacttggacagtctatccttattggaagtg
gttgacttggtggagactactcgggatgttgtagatgatgtgtggagacaaacagagcat
gatcattaccccgagtcgcggatgttacatctcttagatatcataggtggttcatttgga
agatttgttcagaaaaagttgggaactttgaacctatgggaagattcttactatcttgta
aaagaaaatctgaaagctggtatttcaatttgcgagcagtgggtgattgcctgtaatcat
ctaacaggtcaggtgtggcagcgctatgttcctcatccatggaaaaatgaaaaatatttc
cctgaaacacttgacaaacttggcaaacgccttgaagaggtcttggctattagaacaatt
catgagaagcttgtctattttttacctgctggtgaagagaaaattacatgcctggctcga
gtatttgaaccttttactggcttgaatcctgtgcaatataatccatatactgagccttta
tggaaagctgcagtgtctcaatatgaaaaaattattgcacctgcagaaaagaaaatagca
ggaaaattgaaaaattatatttcagaaattcaagatagtccacagcagcttcttcaagca
tttctgaaatataaagagttggtgaagcgtccaactataagcaaagaattgatgttagaa
agagaaactttactggcaagactcgtggactcagttaaagattttcgattagactttgag
aatcgatgccgaggaattcctggtgatgcatctggaccactttctggcaaaaacctttca
gaagttgtcaataatatagtttgggttcgtcagctggaactgaaggtggatgatactatc
aagatagcagaggctcttttatcagacttgtcaggatttcgatctttccatcgaagtgct
gaagatctcttagaccagtttaaactatatgaacaagaacaatttgatgattggtccaga
gatattcaatctggtttgtctgattccagatctggtttgtgtattgaagctaatagtcga
attatggaattggatcctaatgatggatcattaaaagtgcactattcagatcggttggtg
attcttctgagagaagttcgtcagctttctgcacttggctttgttattcctgccaaaata
cagcaagttgcaaacattgcacagaagttctgcaagcaagcaattattcttaaacaagtg
gcacatttttacaattctatcgatcaacaaatgattcaaagtcagaggccaatgatgtta
caatctgccttagcatttgaacagataattaagaattcaaaagcaggaagtggggaaaag
tcacaaattacttgggataatcctaaagaattagaaggctacattcaaaaactccaaaat
gctgctgaacgacttgccactgaaaatagaaaactgagaaaatggcacactacattttgt
gaaaaggtggtaattcttatgaatattgatctgcttcggcagcagcagcgttggaaagat
ggattacaagaattgagaactggcttagcaagtgtagaagcacagggattccaagcaagt
gacatgcatgcgtggaaacagcactggaatcatcaactgtacaaagctctggaacatcaa
tatcagatgggcttagaagcacttaatgagaatctaccagaaataaatatagacttaaca
tacaaacaaggacggttacatttcaggcctccttttgaagaaatccgggccaaatattac
agagaaatgaagagattcatcggtatccctaatcagtttaagggagtgggtgaagcagga
gatgaatctattttttctattatgattgatagaaatgcaagtggatttctgactattttc
agcaaagcagaagatctctttaggagattgtcagctgttttacaacagcataaggaatgg
attgtaattgggcaagttgatatggaagctctagtggaaaagcatctttcaactgttcat
gattgggagaaaaattttaaagcactgaaaataaaaggaaaagaagtagaacgacttcca
agctccgtcaaggtagactgtttaaatattaattgtagccctgtgaagactgtaattgat
gatctcatccagaagttatttgatatgcttgttctttctttgaagaagtccatccaggct
cttttacatgaaatcgatacttttgttactgaagctatggcagtcttatcaattatgccc
cagtctgtggaagagattggtgatgcaaatttacaatatagtaagctacaggaacggaaa
ccagagattttgcccttatttcaagaagctgaagataaaaacagacttttacgaactgtg
gcaggtagaggtttagaaacaattagtaatctgaaagctaagtgggataaatttgaattg
atgatggaaagtcaccaacttatgattaaagatcagattgaagtgatgaaaggaaatgtg
aaatcacgtcttcagatctactatcaagaactggaaaaatttaaagctcgttgggaccaa
ctaaagcctagtgatgatgttattgaagctggccagcaaaatacccttgataagagtgca
aagtcaataaaagagaaaaaaattgagtttgatgatcttgaagccataagaaaaaagctg
gttgatgattgccatcattttggactagaagagcccaacttctctttggcatgtagcatc
tctaaagacattgagagctgtgtacaaatttggacactttatgaagagtttcagcaagga
tttcaggaaatggccaatgaagattggattacttttcggactaagacctatctgtttgag
gaatttttgatgagttggcatgacagattgaggaaggttgaagaacattcagtaatgacg
gtgaaattacaatcagaagttgacaaatataaaattgcagttcctatcttgaaatatgtg
agaggagaacacctttctccagatcactggcttgacctttttcgtttacttggccttcct
aggggtactagtctagagaaattagtgtttggtgatcttctcagagtagctgatacaatt
gttgccaaagcttcagaccttaaagatttaaatagtcgggcacaaggtgaagttacaatc
agagaagctttacgtgaacttgatctttggggtgttggagcagtatttacattgattgat
tatgaagatagccaaagtcgaaccatcaagctgattaaagactggaaagatatagtaaat
caagttggagataacagatgccttcttcaatccttaaaagattctccttattataaaggg
tttgaagataaagtgtcaatttgggaaagaaaacttgcagaattagatgagtacctacag
aatttaaaccatattcagagaaagtgggtatatttggaacccatttttggccgtggagca
ttgccaaaagaacagacacgcttcaacagagttgatgaagattttagatcaataatgact
gacatcaagagagacaacagagtcacaacgttaactactcacgcaggaatcagaaactct
ctactaacaatactcgatcagcttcaaagatgtcagaaatcattaaatgaatttttggag
gaaaaacgctcagcatttccaagattttattttattggtgatgatgacttattagaaata
ctgggtcagtctactaacccatcagtgattcagtctcaccttaagaaactgtttgctggt
attaacagtgtatgttttgatgaggaatcaaaacacataactgcaatgaaatctttagag
ggagaagttgtaccttttaaaaataaagttcttctatcaaataatgtagaaacttggtta
aatgatttagccttggaaatgaagcaaactttgaaacagttattgacagaatgtgttact
actggacaaagttctcaaggtgcagtcgacccctccttattcccttcacagatattatgc
ttggcggagcagattaaattcactgaagatgtagaaaatgctatccaagatcatagtctt
catcagattgaaacacaactggtgaataagttagagcactatactaatattgatacaagt
tctgaggatccagggaatactgaatctggcattctggagcttaaacttaaagcactaatt
cttgacattattcataatatcgatgtggtgaaacagttaaaccaagttcaagttcataca
actgaagactgggcttggaaaaaacaagttagattctatatgaaaagtgatcatacatgt
tatgttcaaatggtggattctgaacttcagtatacttacgagtatcagggtaatgctccc
aagctggtttatactccattgacagacaagtgctacctaactctcactcaagccatgaag
atgggacttggaggaaatccttatggaccagctggaactggaaaaactgaatcagtcaag
gctttaggtggacttcttggaagacaagttttagtgtttaattgtgatgagggcattgat
gtaaagtcaatgggacgaatatttgttggtttggtgaagtgtggggcctggggttgtttt
gatgaattcaatagactggaagaatctgtgctatcagcagtttctatgcagatccagaca
attcaagatgctttaaagaaccatagaactatatgtgaactacttggcaaggaggtagaa
ataaattccaattctggaatttttattactatgaatcctgctggaaaaggttatggagga
agacaaaaactgcctgataatcttaaacagcttttcaggccggtagccatgtctcgtcca
gacaatgagcttattgcagaagttattctctattcagaaggctttaaagatgctaaggta
ttgggcaggaaattggtagctatcttcaatctatctagggaacttttgacacctcagcaa
cattatgactggggtttgagagccttgaagacggttctgagaggaagtggaaatcttctt
agacaactgaagaaaactggcattaaacagaaagttaatgaaagtcatattgtggtacaa
gcgttgaggcttaatacaatgtcgaagtttacatttgtggattgtactcggtttgatgca
ctgattaaggatgtgtttcctggaattgactttaaagaagtagaatatgatgaactgagt
gccgcattaaagcaagtctttgaggaggccaattatgaaatcatacctaatcagatcaag
aaagctttggaattgtatgaacaattacgccagaggatgggagttgttattgttggtcca
agtggcgctggaaaatcaactctttggagaatgttaagggcagcactttgtaaaattggc
caaatagtaaaacaatataccatgaatcccaaagctatgcctagacatcaattattaggc
catattgacatggatacaagagaatggtctgatggtgttttgacgaatagtgctcgccaa
gtagttcgagaaccccaagatgtcagctcatggataatctgtgatggtgatattgaccca
gaatggatagaatctctgaattctgttcttgatgataatcgactactcactatgcccagt
ggagaaaggatccagtttggtccaaatgttaactttgtatttgaaactcatgatttaagt
tgtgcctcaccagccacaatatctagaatgggaatgatctttcttagtgatgaggagacg
gatcttaattctttgataaaatcttggttaaggaatcagcctcctaaatatagaaataac
cttgaaaactggattggaaattattttgaaaaagctttacagtgggttctaaagcagaat
gactacgtggtagaaacgagtttggttgggactgtgatgaacggtttgtcacatctacat
ggatgcaaagatcatgaccaatttattattaatctcataaggggacttggtggaaatttg
aacatgaaatcacgtctggaattcaccaaagaggtttttaattgggcacgagaatctcct
ccggactctcacaaaccaatggacacctactatgattcaagtagaggaagattagcatct
tacgtactgaagaagccagaaaacttgactgccaatgattttagtaatggccaaactctt
ccagtgattcagactccagacatgcaacgaggtctagattatttcaaaccttggttaagt
tctgacactcaacagccatttattcttgtaggaccagaaggatgtggcaaagggatgctg
ctcaggtatgccttttctcaactccggtccacgcaaattgcaacagttcattgtagtgca
caaactacatctcgacatctcctgcagaaattgagccagacctgcatggtaatcagtact
aatactggtagagtgtatagaccaaaagactgtgaaagacttgttttatacttaaaagat
atcaacctaccaaagcttgataaatggggaaccagtacattggtagctttcctacaacag
gtattgacatatcaaggattttatgatgaaaatttggaatgggttggtttagaaaatatt
cagattgtggcttctatgtcagctggaggaagagtgggaagacataagcttactaccaga
tttacttcggttgttcgtctttgtgctatagattacccagaaagagagcagttacagaca
atttatggagcatatttggaaccagttctacataaaaatctgaaaaatcattctatttgg
ggttcttcatcaaaaattaatctcttagcaggatctatggtacaagtgtatgaacaggtg
cgggccaaatttacagttgatgattatagccactacttctttactccttgcatccttacc
cagtgggttcttggcttatttagatatgatttagaaggaggatcttcaaaacatccatta
gattacgtattagaaattgtggcatacgaagcacggcgcttatttcgtgacaaaattgtt
ggtgcaaaagaacttcatttatttgacagcattttaatatcagtgtttcaaggagattgg
ggctcagatatattagacaatatggcagatagtttctatgttacatggggagcccgacat
gattcagcaacaaggacagctccagtacaatcattgcctccacatggaaaaccacttgga
aaactaaattctgcagatctcaaggatgttattaaaaagggtcttattcattatggacgt
gataaccagaatttagatatcttacttttccaagaagtcctcgagtatgtgtctaggata
gatagagtgctgagttttcccggaggttcccttctattagcaggacgcagtggcgtaggt
cgtcggaccatcacttctttagtcagtcatatgcatggagcagtgctgttttctccaaaa
atttctagaggatatgaactgaagcagttcaaaaatgatctcaaacatgtgttgcatctt
gcaggtattgaagcacaacaggtagttttacttctcgaggattaccagtttgtacatccc
acatttttggagatgatcaatagccttttgtcatcaggtgaagttcctggactctatact
cttgaagaattagagcccttgctgttgcctcttaaagatcaggcttcacaagatggtttt
ttcggaccagtcttcaattacttcacatatcgaattcaacaaaacttgcatattgtcttg
ataatggattctgcaaatttaaacttcataattaactgtgagagtaatccagcattgcat
aagaaatgccaggtgttgtggatggagggttggtcagatagcagcatgaagaaaatacct
gaaatgttattcaatgaaacaggtagtgaagaaaaatgtagtgacaaaaaaggaaaagaa
gaaaagaaaaaaaattcagttgatcctgattttctaaaatcatttttattaatccacgaa
tcctgtaaagcatatggtgctacaccaagccgatatatgacctttttacatgtgtattct
gccattagtagcagcaagaaaaaggaattattaaaaagacagagtcatttgcaggctggt
gtatcaaagcttaatgaagctaaagctcttgtggatgaactgaacagaaaagctggggaa
caaagtgtattacttaaaactaagcaagatgaagcagatgctgcccttcaagagatcaca
gtatcaatgcaggatgccagtgagcaaaagacagaacttgaaagactgaagcacaaaata
gcagaagaagttgttaaaattgaagaaagaaaaaacaaaattgatgatgaattaaaagag
gtacagcctctagtcaatgaagctaaactagcagttggaaacattaagccagaatccctt
tcagaaattcgctcactgcgtatgccacctgatgtaattagagacattcttgaaggtgtt
ttaaggttgatgggtatctttgatacatcttgggtgagcatgaaaagtttccttgcaaaa
agaggtgtgagagaagacatagcaacctttgatgcacgaaatattccaaaggaaataaga
gaaagtgttgaagaacttctttttaaaaataaaggatcttttgatccaaagaatgctaag
cgtgccagtactgcagccgctcctttggctgcctgggttaaagcaaatgtgcagtattcc
catgtcttggaacgaattcagcctttggaaaccgaacaggcgggattagaatcaaatttg
aagaaaactgaagacagaaaaaggaaactagaggaacttcttaattctgttggtcaaaaa
gtatcagaactcaaagagaaatttcagagcaggacttcagaagctgccaaacttgaatct
gaagtgagcaaagcacaagaaacaattaaagctgcagaagtcttaattaatcagctggat
agagaacacaagagatggaatacacaggttgcagagataacagaggaattagctactctt
cctaaacgagctcaactagctgctgcatttattacatatctctctgctgctcctgagggt
ctgagaaaaacctgtttggaagaatggtctaagtcagcttgtcttgaaaaatttgatctg
aggagatttctttgtaccgaaagtgagcagttaatttggaaaagtgaaggactaccatca
gatgacctatccatagaaaatgctattgttatcttacagatcattggtttgaaatcatgg
agtcgagtatgcccatttcttatagacccttcttcccaagctacagaatggttaaagaca
catctgaaagactcgcgtttggaagttattaaccagcaggataataactttatcacagct
cttgagttggcagtacgttttgggaaaacccttataatacaagagatggatggcgtagaa
cctgttctttatccattgttgagacgagatctggttgctcaaggaccacgctttgtggtg
caaattggtgacaaaattattgattacaatgaagagttccgcctttttttgtcaacaaga
aacccaaatccctttattccgcctgatgcagcttccattgttactgaggttaactttact
acaacaagaagtggattacgaggacagctgttggctttaacaattcaacatgagaaacct
gatttagaggaacagaaaacaaaactattacaacaggaagaagataagaaaatacagtta
gctaagcttgaggaatctcttttagagacacttgctacatctcaaggcaatattttggaa
aataaagatttaattgaatctttgaatcagaccaaagcaagcagtgcacttattcaagag
tcacttaaagaatcttacaaactccaaattttccttgatcaggagcgcgatgcctatcta
cccctggctgagagtgccagcaagatgtacttcattatctctgacttgtccaaaattaat
aacatgtaccgttttagtttggctgcatttcttcgactttttcagcgagctctgcaaaac
aaacaggattctgaaaatacagaacagcgaatccagtctcttatcagctcattaaaacat
atggtatatgaatacatatgccgctgtctttttaaggctgatcaattgatgttcgctttg
cattttgttcgaggcatgcatcctgaactttttcaggaaaatgaatgggatacgtttaca
ggtgtagttgttggagacatgttgcggaaagctgactcccaacaaagaattcgtgatcaa
cttccatcttggatagatcaggaaagaagctgggcagtagcaacattaaagattgctctt
cccagtctttttcagaccctctgctttgaagatgttgctctgtggcgtacgttttatcat
aattcaatgtgtgagcaagagtttccatctattcttgcaaagaaagtttccttatttcag
caggttcttgtggtacaggctctcagaccagacagactgcaaagtgccatggccttgttt
gcatgtaaaactctgggactgaaggagttgtccccactccctttaaatctcaaacgtttg
tacaaagagacactagaaatcgaacccatcttgataattatttccccgggtgctgatcct
tctcaggaactgcaagaacttgctaatgctgaaagaagcggagagtgttatcaccaggtt
gccatgggtcaaggtcaagccgatttagcagttcaaatgctaaaagaatgtgcgcgcaat
ggagactggctctgtttgaagaacttacatcttgtggtgtcttggcttccggttctggaa
aaggaattaaatactcttcaacctaaagatacctttcgtctttggcttactgcagaagtt
catcccaactttactcctattttattacagtcaagtttgaagataacatatgagtcacct
ccaggtctgaagaagaatttaatgcggacttatgaatcttggactcctgagcaaattagc
aaaaaagataatatacatcgagctcatgctctcttcagttttgcatggtttcatgctgca
tgtcaagaaagaagaaattatattccacagggttggaccaaattttatgagttttcttta
tcagatcttcgagctgggtacaacgttattgacaggctctttgatggtaccaaagatata
caatgggaatttgtacatggcttacttgagaatgctatttatggaggacgtatagataac
tattttgaccttagagttcttcagtcgtacctgaaacagttttttaattcttcagcaatt
gatgtattaaaccaaaggaacaagaagagccttttcccattttccttatctctaccaaaa
tcctgcagcattttggattatcgtgccatcattgagaaacttccagaggatgacaaacct
attttctttggtctgcctgccaacattgctcgctcatctcagcgcatgatcagttctcag
gttatttcacagttgaggatcttgggcagatcagtaacagctggttgcaaatttgataga
gaaatctggtctaatgaactttctcctgttctcaatctctggaagaaactaaaccagaat
tcaaacctgattcatcagaaagtgtctcctcctaatgatcgacaaggatctccaatatta
tcattcatcgttcttgaacaatttaatgccattcgcttggtacaaagtgttcatcagtct
cttgctgctctcagcaaagtcatcagaggaaccaccttactgagttcagaagtacaaaaa
ttggcaagtgctttattaaaccaaaagtgtcctctcacatggcagagcaagtgggaaggc
ccagaagatcctttacaataccttagaggtcttgtagctcgtgcccttgcaatacagagc
tgggtagagagagctgaaaagcaggctcttctctctgatacacttgacctatcagaactc
ttccacccagacacatttctcaatgctcttcgccaagaaactgcaagggccatgaactgt
tctgtggatagccttaaatttgtagcctcatggaagggtcgactgcaagaagcaaagctg
cagattaagatcagtggcttattactggagggatgcagttttgatggaaatcgactttct
gaaaatcagcatgattctcctagtgtatcatcagttctcccttgttttatgggctggatt
ccacagggtgcatacggtccatattccccagaagagagtatatctttgcctgtttacacg
agtgctgaaagggatcgtgtggtaaccaatatcgatgttccatgtggaggcaatcaagac
cagtggatccagtgtggggcagctctctttctgaaaaatcagtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521376
Entry
107521376         CDS       T06036                                 

Gene name
DYNC1H1
Definition
(RefSeq) cytoplasmic dynein 1 heavy chain 1 isoform X1
  KO
K10413  dynein heavy chain 1, cytosolic
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04962  Vasopressin-regulated water reabsorption
ray05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107521376 (DYNC1H1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107521376 (DYNC1H1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107521376 (DYNC1H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107521376 (DYNC1H1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107521376 (DYNC1H1)
   04147 Exosome [BR:ray04147]
    107521376 (DYNC1H1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      107521376 (DYNC1H1)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     107521376 (DYNC1H1)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107521376 (DYNC1H1)
SSDB
Motif
Pfam: DHC_N1 AAA_6 DHC_N2 AAA_9 AAA_8 Dynein_C AAA_7 AAA_lid_11 MT AAA_5 Dynein_heavy Dynein_AAA_lid AAA AAA_22 AAA_33 AAA_18 Mg_chelatase T2SSE AAA_19 AAA_lid_1 AAA_25 IstB_IS21 POT1PC
Other DBs
NCBI-GeneID: 107521376
NCBI-ProteinID: XP_016021488
LinkDB
Position
Unknown
AA seq 4650 aa
MSEPGGGGGGGGGEDGSAGLEVSAVQNVADVSVLQKHLRKLVPLLLEDGGEAPAALEAAL
EEKSALEQMRKFLSDPQVHTVLVERSTLKEDVGDEGEEEKEFISYNINIDIHYGVKSNSL
AFIKRTPVIDADKPVSSQLRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGD
KMAPSVEKKIAELEMGLLHLQQNIEIPEISLPIHPIITNVAKQCYERGEKPKVTDFGDKV
EDPTFLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALYRIQEKRESPE
VLLTLDILKHGKRFHATVSFDTDTGLKQALETVNDYNPLMKDFPLNDLLSATELDKIRQA
LVAIFTHLRKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVAC
FEVFQTWDDEYEKLQVLLRDIVKRKREENLKMVWRINPAHRKLQARLDQMRKFRRQHEQL
RAVIVRVLRPQVTAVAQQNQGEVPEPQDMKVAEVLFDAADANAIEEVNLAYENVKEVDGL
DVSKEGTEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPH
IRGAIREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDR
QLTAYMKRVEDVLGKGWENHVEGQKLKQDGDSFRMKLNTQEIFDDWARKVQQRNLGVSGR
IFTIESTRVRGRSGNVLKLKVNFLPEIITLSKEVRNLKWLGFRVPLAIVNKAHQANQLYP
FAISLIESVRTYERTCEKVEERNTISLLVAGLKKEVQALIAEGVALVWESYKLDPYVQRL
AETVFNFQEKVDDLLIIEEKIDLEVRSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNL
PIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAGDKAEVDMDTDAPQVSHKPGGEPKVK
NVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMIVLSLPRIQSQRYQVGVHYELTEEE
KFYRNALTRMPDGPVALEESYSAVMGIVTEVEQYVKVWLQYQCLWDMQAENIYNRLGEDL
NKWQALLVQIRKARGTFDNAETKKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLG
SNMTEFHSQISKSRQELEQHSVDTASTSDAVTFITYVQSLKRKIKQFEKQVELYRNGQRL
LEKQRFQFPPSWLYIDNIEGEWGAFNDIMRRKDSAIQQQVANLQMKIVQEDRAVESRTTD
LLTDWEKTKPVKGTLRPEEALQALTIYEGKFGRLKDDREKCAKAKEALELTDTGLLSGSE
ERVQVALEELQDLKGVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNLDGLLNQLKNFPAR
LRQYASYEFVQRLLKGYLKINMLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWD
VDLQKNEAIVKDVLLVAQGEMALEEFLKQIREVWNTYELDLVNYQNKCRLIRGWDDLFNK
VKEHINSVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSAD
IKHLLPVETQRFQSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGKIQKALG
EYLERERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILNEDNSVVLGI
SSREGEEVMFKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTEVEIFGKATSIDPS
TYITWIDKYQAQLVVLSAQIAWSENVETALSSIGGSGDAAPLHSVLSNVEVTLNVLADSV
LMEQPPLRRRKLEHLITELVHQRDVTRSLIKSKIDNSKSFEWLSQMRFYFDPKQTDVLQQ
LSIQMANAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESV
KALGHQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQVQ
CIQEALREHSNPNYDKTSAPITCELLNKQVKVSPDMAIFITMNPGYAGRSNLPDNLKKLF
RSLAMTKPDRQLIAQVMLYSQGFRTAEVLANKIVPFFKLCDEQLSSQSHYDFGLRALKSV
LVSAGNVKRERIQKIKREKEERGEAVDEGEIAENLPEQEILIQSVCETMVPKLVAEDIPL
LFSLLSDVFPGVQYHRGEMTALREELRKVCQEMYLTYGDGEEVGGMWVEKVLQLYQITQI
NHGLMMVGPSGSGKSMAWRVLLKALERLEGVEGVAHIIDPKAISKDHLYGTLDPNTREWT
DGLFTHVLRKIIDNVRGELQKRQWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLP
PNVRVMFEVQDLKYATLATVSRCGMVWFSEDVLSTDMIFNNFLARLRSIPLDEGEDEAQR
RRKSKEDEGEEAASPMLQIQRDAATIMQPYFTSNGLVTKALEHAFKLEHIMDLTRLRCLG
SLFSMLHQACRNVAQYNANHPDFPMQIEQLERYVQRYLVYAILWSLSGDSRLKMRAELGE
YIRRITTVPLPAAPNVPIIDYEVSISGEWSPWQAKVPQIEVETHKVAAPDVVVPTLDTVR
HEALLYTWLAEHKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFD
HYCEYRRTPNGVVLAPVQLGKWLVLFCDEINLPDMDKYGTQRVISFIRQMVEHGGFYRTS
DQTWVKLERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGPASLTQIYGTFNRAML
RLIPSLRTYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMTRWVRGIFEALRPLETL
SVEGLVRVWAHEALRLFQDRLVGDEERRWTDENIDMVALKHFPNIDKERATSRPILYSNW
LSKDYIPVDQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLI
GVSGAGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEKIAFIMDE
SNVLDSGFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDSHEELYRWFTS
QVIRNLHVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLE
KPNYIVPDYMPLVYDKLPQPPSHREAIVNSCVFVHQTLHQANARLAKRGGRTMAITPRHY
LDFINHYANLFHEKRSELEEQQMHLNVGLRKIKETVDQVEELRRDLRIKSQELEVKNAAA
NDKLKKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEPAVIEAQNAV
KSIKKQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSVIMRENFIPTIVNFSA
EEISDAIREKMKKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNEL
QKLEDDARDNQQKANEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNRST
ALLKSLSAERERWEKTSETFKNQMSTIAGDCLLSAAFIAYAGYFDQQMRQNLFTTWSHHL
QQANIQFRTDIARTEYLSNADERLRWQASSLPADDLCTENAIMLKRFNRYPLIIDPSGQA
TEFIMNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPVLNPVLNREVRRT
GGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLNEV
LKAERPDVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLKRE
AAEVTRKVEETDIVMQEVETVSQQYLPLSTACSSIYFTMEALKQIHFLYQYSLQFFLDIY
HNVLYENPNLKGVTDHTQRLSSITKDLFQVAFNRVARGMLHQDHITFAMLLARIKLKGTI
GEPTYEAEFQHFLRGKEIVLSAGSTPAIRGLTVEQAEAVVRLSCLPAFKDLIAKVQADEQ
FGIWLDSSSPEQTVPYLWSEDTPATPIGQAIHRLLLIQAFRPDRLLAMAHLFVSTNLGES
FMSIMEQPLDLTHIVDTEVKPNTPVLMCSVPGYDASGHVEDLAAEQNTQITSIAIGSAEG
FNQADKAINTAVKSGRWVMLKNVHLAPGWLMQLEKKLHSLQPHACFRLFLTMEINPKVPV
NLLRAGRIFVFEPPPGVKANMLRTFSSIPVARICKSPNERARLYFLLAWFHAIIQERLRY
APLGWSKKYEFGESDLRSACDTVDTWLDDTAKGRQNISPDKIPWSALKTLMAQSIYGGRV
DNEFDQRLLNTFLERLFTTKSFDSEFKLACKVDGHKDIQMPDGIRREEFVQWVELLPDAQ
TPSWLGLPNNAERVLLTTQGVDMISKMLKMQMLEDEDDLAYAEAEKKARTDSTSDGRPAW
MRTLHTTASNWLHLIPQTLSHLKRTVDNIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQ
VCEGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQLQNISLAA
ASGGAKELKNIHVCLGGLFVPEAYITATRQYVAQANSWSLEELCLEVNVTTSQSAALDAC
SFGVTGLKLQGATCSNNKLSLSNAISTVLPLTQLRWVKQTNAERKASVVTLPVYLNFTRA
DLIFTVDFEIATKEDPRSFYERGVAVLCTE
NT seq 13953 nt   +upstreamnt  +downstreamnt
atgtcggagcccggtggcggcggcggcggcggcggcggcgaggacggctcggccggcctg
gaggtgtcggcggtgcagaacgtggccgacgtgtcggtgctgcagaagcacctgcgcaag
ctggtgccgctgctgctggaggacggcggcgaggcgccggccgcgctcgaggcggcgctg
gaggagaagagcgccctggagcagatgcgcaagttcctctcggacccgcaggtccacacg
gtcctggtggagcgctccacgctcaaagaggatgttggtgatgaaggagaggaagaaaaa
gaattcatttcctataacatcaacatagacattcattatggagttaagtccaacagcttg
gcattcattaaacgtactccagtaattgatgcagacaaaccagtgtcttcccagctccga
gtcctcacgctcagtgaagactcaccgtatgaaaccttgcattctttcattagcaatgcg
gtggctcctttttttaagtcctacatcagagagtctggcaaagcagacagggatggtgat
aaaatggctccttcagttgaaaaaaagattgcagaacttgaaatggggctccttcacctg
cagcaaaatattgaaattccagagatcagcctgccaattcatccgattattacaaatgtg
gcaaaacagtgttatgaacgtggagaaaagccgaaagttacagactttggagataaggtt
gaagacccaacttttctcaatcagctacagtctggagttaaccgctggatccgagaaatt
cagaaagtgaccaaacttgatcgagatcctgcttcaggaactgccttacaggaaatcagt
ttttggctaaacttggaacgtgcattataccgcatacaggagaaacgagagagcccagaa
gttctccttactctggacatcttgaaacatggcaagcgattccacgccactgtcagtttc
gacaccgacacagggctaaaacaggctttggaaactgtgaatgactataaccctctcatg
aaagattttcctctgaatgacctgctgtctgccactgaactggacaaaataaggcaggca
cttgtggcaattttcacccatttgcgaaagatccgaaacaccaagtatcccattcagagg
gcgctgcgcctggtggaggccatctcaagagacctgagttctcagttactcaaagtgctg
ggtaccaggaaactgatgcatgtcgcttatgaagaatttgagaaagttatggttgcgtgc
tttgaggtgtttcagacttgggacgatgagtatgagaaactgcaggtgttgctgagagac
attgtcaaaaggaaaagggaagagaatctgaagatggtgtggcgcatcaaccccgctcac
aggaagcttcaggctcgcctggaccagatgagaaagtttaggcgccagcacgaacagctg
agagctgtcatcgtcagggtcctgaggccacaggtcacggcagtggcacaacagaatcaa
ggagaggtgcctgaaccccaggatatgaaagtagctgaggttctcttcgatgctgccgac
gcgaatgccatcgaggaggtgaacctcgcctacgagaatgtcaaggaggtggacgggctg
gacgtctccaaagaaggcacggaggcgtgggaggccgcgatgaagcgctacgacgagagg
atcgacagggtggagacccgcatcacggcccgcctccgcgaccagctgggcacggccaag
aacgccaacgagatgttcaggattttctcccggttcaacgcgctgttcgtccggcctcac
atccgcggggccatccgggaataccagacccagctcatccagcgtgtgaaggacgacatc
gagtcccttcacgacaagttcaaagtccagtacccgcaaagccaggcgtgcaagatgagc
cacgtgcgcgacctcccgcccgtgtcgggctccatcatctgggccaaacagatcgacagg
cagctgacggcctacatgaagcgcgtggaggacgtcctgggcaagggctgggagaaccac
gtggaagggcagaagctgaagcaggacggcgacagcttccgcatgaagctcaacacccag
gagatattcgacgactgggcccgcaaggtgcagcagcgcaacctgggcgtctcggggcgc
atcttcaccatcgaaagcacgcgcgtccggggccgatccggaaacgtcctcaagctcaag
gtcaacttcctccccgagatcatcacgctttcaaaagaggttcgaaacctcaagtggctt
ggtttccgagtcccgctggcgattgtgaacaaggctcatcaagcgaaccagctttaccca
ttcgccatctccctgatcgaaagcgtccgcacgtacgagcggacctgcgagaaggtggag
gagcggaacaccatctccctgttggtggccggcctgaaaaaggaggtgcaggccctgatc
gcagagggcgtcgccctggtgtgggaatcctacaagctcgacccgtacgtgcagcgactg
gcagagactgtcttcaacttccaggagaaggtggatgatctgctgatcattgaagaaaaa
atagacctggaggtccgttccttagaaacttgcatgtacgaccataagactttctcagag
atcctgaacagagtccagaaggccgtggacgacttgaacctgcactcctactccaatctg
cccatctgggtcaacaagctcgatatggagattgaaagaatattgggcgttcgcctacaa
gctggcctgagagcctggacccaggtgcttcttggacaggctggagataaagcagaagtg
gacatggacacagacgcgccgcaagtcagccacaagcctggcggagagccgaaggtcaaa
aacgtggtacatgagctaagaataaccaatcaggtcatctatctgaacccgccaattgaa
gagtgcaggtacaagctgtatcaggaaatgttcgcctggaagatgatcgtgctgtctctc
cccaggatccagagtcagaggtaccaggtgggcgtccattacgaattgactgaagaagag
aaattctaccggaacgcgttgacacgaatgcctgatggcccagtcgccctggaagagtcc
tactctgcagtcatgggcatcgtgacggaagtcgagcagtacgtcaaggtgtggcttcag
taccagtgcttatgggacatgcaggccgaaaacatctacaacagactaggggaggacctc
aacaagtggcaggcgctcttggtccagataaggaaggccagaggaactttcgacaacgca
gaaaccaagaaagagtttggacccgtcgttatagattacggcaaggtgcagtcgaaggtg
aacttgaagtacgactcttggcataaggaggttctcagcaaatttgggcagatgctcggc
tcaaacatgacagagttccattcccagatctccaagtctcgccaggagctggagcagcac
tcggtggacacggccagcacctccgacgcggtgaccttcatcacctacgtgcagtctctg
aagcggaagatcaagcagtttgagaagcaagtcgagctctaccgcaatggccagcgcctg
ctggagaagcagaggttccagttcccgccttcctggctgtacatcgacaacatcgaggga
gagtggggggccttcaatgacatcatgcggcggaaggactctgccattcagcagcaggtg
gcaaacctgcagatgaagatcgtgcaggaggaccgagccgtggagagccgcaccactgac
ctgctgaccgactgggaaaagaccaagcccgtcaagggcaccctgcgtccggaggaggca
ctgcaggccctcaccatctacgagggcaagttcggcaggctgaaggatgaccgtgagaag
tgcgccaaggccaaggaggccctggagttgacggacaccgggctcctcagtggcagcgag
gagcgtgtccaggtggccttagaagaattacaggacctcaaaggcgtttggtcagagctt
tccaaggtctgggagcagatcgaccagatgaaggagcagccgtgggtctccgtgcagccc
cggaagcttcgacaaaatttagatggcctcttgaaccagttgaaaaactttcccgcacga
ttacggcagtacgcgtcctatgaatttgtccagaggcttctgaaaggttacctaaagatc
aacatgctggtcattgagctgaaatccgaggcgctgaaagaccgccactggaaacagctg
atgaagaggctccacgtgaactgggtggtgtctgagctaaccctcggccagatctgggat
gtcgacctgcagaagaacgaagccatcgtcaaggacgtgctgctcgtggcgcagggggaa
atggccctggaagagtttctgaagcagatacgagaagtgtggaacacgtacgaattagac
ttggttaattaccagaacaagtgtcgcttgattcgtggctgggacgaccttttcaacaag
gtcaaagagcacatcaacagtgtctccgccatgaagctctctccatactacaaggttttc
gaggaggacgccctgagctgggaagacaagctgaaccgcatcatggccctctttgacgta
tggatcgacgtccagaggcgctgggtctacctggaaggcatcttcacgggcagtgcagac
atcaagcacctgctgcctgtggaaacgcagcgcttccagagtatcagcacggagttcctg
gcgctgatgaagaaggtgtcgaagtctccacttgtgatggacgttctcaacatccagggg
gtgcagcggtctctagagagactggcggaccttctgggaaagatccagaaagcgctggga
gaatacctggaaagagagcggtcatctttccccaggttctattttgtgggcgatgaagat
ttgcttgaaatcattggaaatagcaagaatgtagctaaattacagaaacacttcaagaaa
atgtttgctggggtttcgagcattattctgaacgaggataactccgtcgtcctgggcatt
tcatcccgcgaaggagaggaggttatgtttaaaactcctgtgtcaattactgagcatccc
aaaatcaatgagtggctcacgctggtagaaaaggagatgagagtcactctggctaagctc
ctggctgagtcggttacagaagttgagatttttggtaaagcaacttcaattgaccccagt
acctacatcacttggattgacaaatatcaggcccagcttgtggttctgtcagcccagata
gcctggtctgaaaacgtggagacggctctgagcagcatcggcgggagtggagacgcggcg
cccttgcactccgtgctgagcaacgtggaggtcacgctcaacgtgctggccgactcggtc
ctcatggagcagccgccgctccgcaggcggaagctggagcacctgattacagagttggtt
caccagagagacgtgaccagatccctcatcaaaagcaagatcgacaacagcaagtccttc
gagtggctcagccagatgcggttttactttgacccgaagcagacggatgtgttacagcag
ttgtccatccaaatggcaaacgccaagtttaactatggctttgagtacctgggcgttcag
gacaagctggtccagacccccctcaccgaccgctgctacttgacgatgacacaggccttg
gaggccaggctgggcgggtccccatttgggcctgcggggactgggaagaccgagtctgtc
aaagctctgggccatcagctcggacgctttgttttggttttcaactgtgacgagaccttc
gatttccaggcgatgggacggatcttcgtggggctttgccaggtgggggcgtggggctgc
ttcgatgagttcaaccgcctggaggagcgcatgctgtcggctgtgtcccagcaggtgcag
tgcattcaggaagcgctgcgtgagcactccaaccccaactacgacaagacctctgcgccc
attacctgcgagctgctcaacaaacaagtcaaggtgagcccagacatggccatcttcatc
accatgaaccctggctacgcaggccggtcgaacctccccgacaacctgaagaagctgttc
cggagcttggccatgaccaagcccgaccggcagctcatcgcccaggtcatgctgtactca
cagggcttccgcaccgccgaggtccttgccaacaaaatcgtcccgttctttaaactatgt
gatgagcagctctcttctcaaagtcattatgactttggtcttcgagccctgaagagtgtg
ttggtgagtgcggggaacgtgaagagggagagaattcagaagataaagagggagaaagaa
gaacgaggtgaagcggtcgatgaaggagaaattgcagaaaatctacccgaacaagagatt
ctgatacagagcgtgtgtgagacgatggtgccaaagctggtggcagaggacatcccgctg
ctcttcagtctgctgtcggacgtgttccccggggtccagtatcaccgcggcgagatgacc
gcccttcgcgaagagctgcggaaagtctgccaggaaatgtacctgacgtacggagacgga
gaggaagttggcgggatgtgggttgaaaaggttctccagctctaccagatcacccagatc
aaccacggcctgatgatggtggggccctcgggcagcggcaagagcatggcctggcgcgtt
cttctgaaggctttggagagactggagggtgtggagggtgtggcccatatcatcgacccc
aaggccatcagcaaagaccacctctacggaaccctggaccccaacaccagggaatggaca
gatgggctgttcacgcacgttctaaggaagatcatcgacaacgtgcggggcgagctgcag
aagcgccagtggattgtcttcgacggcgacgtggaccccgagtgggtcgagaacttgaac
tcggtgctggatgacaacaagctgctgactctgcccaacggggagcgcctcagcctcccg
cccaacgtgcgagtgatgttcgaagtgcaggacttgaagtacgccacgctggccacggtg
tcgcgctgcggcatggtctggtttagcgaggacgtgctcagcacggacatgatcttcaac
aacttcctggccaggctgcgcagcatcccgctggacgaaggggaggacgaggcccagcgc
cggcgcaagagcaaggaggacgagggcgaggaggcggcttccccgatgctgcagatccag
agggacgcagcgaccatcatgcagccgtacttcacgtccaacggcctggtcaccaaggcg
ctggagcacgccttcaagctggagcacatcatggacctgacgcgcctgcgctgcctgggc
tcgctcttctccatgctgcaccaggcctgccgcaacgtggcgcagtacaacgccaaccac
cccgacttccccatgcagatcgagcagctggagcgctacgtgcagcggtatctggtttac
gccatcctctggtccttgtctggagacagtcggctgaaaatgagagcggagctgggtgaa
tacatcaggaggatcacgaccgtgccgctgccggccgcccccaacgtcccgattatcgat
tacgaagtgtccatcagtggagagtggtcgccgtggcaggccaaggtgcctcagatcgaa
gtagagacccacaaggtggcggcccctgacgtcgtcgtgccgaccctggacaccgtccgc
cacgaagccctcttgtacacctggctggccgagcacaagcccctggtcctgtgcggcccc
cctgggtccggcaagaccatgaccctcttcagcgccctccgggccttgcccgacatggag
gttgtgggcctgaacttctcaagcgccacgaccccggagctcctgctgaagaccttcgac
cactactgcgagtaccggcgcaccccaaacggcgtcgtcctggccccggtgcagctcggg
aagtggctggtgttgttctgcgacgagatcaacctgccagacatggacaagtacgggacg
cagagggtcatatccttcatcagacagatggtggagcacggaggcttttaccgaacctca
gaccaaacgtgggtgaagctggagaggatccagttcgtcggggcctgcaacccgcccacg
gaccctggaaggaagcccctctctcacaggttcctgcgccacgtgcccgtggtgtacgtg
gactaccccgggcccgcctccctgacgcagatctacggcaccttcaaccgggccatgctg
cggctcatcccgtcgctgcgcacgtacgcggagccgctcaccgccgccatggtggagttc
tacaccatgtcgcaggagcggttcacgcaggacacgcagccccactacatctactcgccc
cgcgagatgacgaggtgggtgcgcggcatcttcgaggcgctgaggcccctggagaccctg
tccgtggaaggcctcgttcgggtgtgggcacacgaagccctccgtctcttccaagacaga
ctcgtgggggacgaggagcgacgctggacggacgagaacatcgacatggtggccctgaag
cacttccccaacatagacaaggagcgggcgacgagccggcccatcctgtacagcaactgg
ctgtcaaaggactacatcccagtagaccaagaagagctaagagattatgtcaaagccagg
ctgaaagtcttctacgaggaagaactggatgtccctctggtcctgttcaatgaagtgtta
gaccacgtgctcaggatcgaccgaatattccgccagcctcaaggccacttgcttctgatc
ggtgtcagcggagcaggaaaaaccactctgtcccgcttcgtggcctggatgaacgggctg
agcgtgtaccagatcaaggtgcacaggaagtacaccggggaagacttcgatgaggatctt
cggacggtgttgagacgctctggctgtaaaaatgaaaagatagcatttatcatggatgag
tccaatgtattggattctggattcctggagcgaatgaacacacttctggccaacggagag
gtccccggtctcttcgaaggagatgagtacgccaccttgatgacgcagtgcaaggagggg
gcgcagaaggagggcctgatgctggactcgcacgaggagctgtaccggtggttcaccagc
caggtcatccgcaacctgcacgtcgtcttcaccatgaacccgtcctccgaggggctcaag
gaccgtgcggccacctcccctgcactttttaaccggtgtgtgctgaattggtttggggac
tggtccacggaagctctgtatcaagtcggcaaagaattcacaagtaagatggacctggag
aagccgaactacattgtgcccgattacatgccactcgtgtatgacaagctgccgcagccc
ccgtcgcatcgggaagccatcgtgaatagctgtgtgtttgttcatcagactcttcaccag
gccaacgctcggctagccaagcgaggcggcaggaccatggccatcacgccccggcactac
ctggacttcatcaaccattacgccaacctgttccacgagaagcggagcgagctggaggag
cagcagatgcacctgaacgtggggctccggaaaatcaaagagaccgtcgaccaggtggaa
gagctgcgtcgtgacttgaggataaagagccaagagctggaggtgaagaacgcggcggcc
aacgacaagctgaagaagatggtgaaggaccagcaagaggccgaaaagaaaaaggtcatg
agccaagaaattcaggagcagctgcataagcagcaggaagtaattgcagacaaacaaatg
agcgtcaaagaggacctcgacaaggtggagcccgccgtcatcgaggcccagaatgccgtg
aagtcgataaagaagcagcacctggtggaggtgcgctccatggccaacccgcccgcggcc
gtgaagctggcgctcgagtccatctgcctgctgctgggggagagcacgacggactggaag
cagatccgctccgtcatcatgcgcgagaacttcatccccaccatcgtgaacttctccgcc
gaggagatcagcgacgccataagggagaagatgaagaaaaactacatgtccaacccaagc
tacaactacgaaatcgtgaaccgggcttcgctggcctgcggtcccatggtgaaatgggcc
atcgcccagcttaactacgcagacatgctgaagcgggtggagcccctgcgcaacgagctg
cagaagctggaggacgacgccagggacaaccagcagaaggccaacgaggtggagcagatg
atccgcgacctggaggccagcatcgcccgctacaaggaggagtacgcggtgctcatctcc
gaggcccaggccatcaaagcagacctggccgccgtcgaggccaaagtgaaccggagcact
gcccttctgaagagtctgtctgccgaacgcgaacgatgggaaaaaacaagtgaaactttc
aaaaaccagatgtctaccatcgctggggactgccttttgtcggccgcgtttattgcttat
gcgggttattttgaccagcagatgcggcagaacttgtttaccacgtggtcccatcactta
cagcaggccaacatccagttccgcacagatatcgcaaggaccgagtatctttccaacgct
gacgagcgccttcgctggcaggccagctccttacctgcagacgacctgtgcacggagaat
gcgatcatgctgaagcgcttcaacaggtacccgctgatcattgacccctccggacaggcc
acggagttcattatgaacgagtacaaggaccgtaagatcacgcggaccagcttcctggat
gacgccttcaggaagaacctggagagcgcactgcggttcggcaaccccctgctggtgcag
gatgtggaaagctacgatccagttctgaatccagtgctgaaccgcgaagtccggcgaacg
gggggtagagtgctgattaccctcggtgaccaagatatagacctgtccccatcattcgtc
atcttcttgtccacccgcgatccaaccgtcgagttcccaccagatctctgctcccgggtc
acgtttgtcaacttcacagtcacccgaagcagtttacaaagccagtgtctaaatgaagta
cttaaagcagagagacccgacgtggacgaaaaacgttctgatcttcttaaacttcaaggc
gagtttcagctgcgtctgcgtcagctggagaagtctctgctgcaagctctgaacgaggtg
aaagggcgcattttggacgacgacacgatcataacgactctggagaacctcaagagggag
gcggccgaggtgacgaggaaagtcgaggagaccgacatcgtgatgcaggaggtggagacc
gtgtcccagcagtacctgccgctgtccaccgcctgcagcagcatctacttcaccatggag
gccctgaagcagatacacttcctgtaccagtactccctccagttcttcctggacatctac
cacaacgtcctgtacgagaacccgaacctgaagggcgtcacggaccacacgcagcgcctc
tccagcataacgaaggacctcttccaggtggcgttcaaccgggtggccaggggcatgctg
caccaggaccacatcaccttcgccatgctgctggcgagaatcaagctgaagggcacgatc
ggggagcccacctacgaggccgagttccagcacttcctgagagggaaggaaatcgtgctg
agcgccggctcgacgcccgcgatccggggcctgactgtggagcaggccgaagcggtggtg
cgtctgagctgtctcccggcgtttaaggatctgatcgcaaaggttcaggccgacgagcag
ttcggcatctggctggacagcagctccccagagcagacggtgccgtacctctggagtgaa
gacacacctgcaacgcccatcgggcaggccatccaccgcctgctcctgatccaggctttc
cgccccgaccgcctgctggccatggcccacctgttcgtctccacgaacctcggcgagtcc
ttcatgtccatcatggagcagccactcgacctgacccacatcgtggacacagaggtgaag
ccaaacacgcccgtcctgatgtgctctgtgcctggttacgatgccagcgggcatgtcgag
gacctcgcggctgagcagaacacgcagatcacctcgatcgccatcggctcggcagaaggc
ttcaaccaggcagataaggcgataaacacggccgtgaagtcgggcaggtgggtgatgctg
aagaacgtgcacctggcgccggggtggctgatgcagctggagaagaagctgcactccctg
cagccgcacgcctgcttccggctcttcctcaccatggagatcaaccccaaggtgcctgtg
aacctgctgcgcgccggccgcatcttcgtgttcgagccacccccgggggtgaaggccaac
atgctgaggacgttcagcagcatccccgtggcgcgcatatgcaagtctcccaacgagcgc
gctcgcttgtacttcctgctggcctggttccatgccatcatccaagaacgcttacggtac
gcgcctctggggtggtcgaagaagtacgaatttggggagtccgacctgcggtcagcctgc
gacacggtggacacgtggctggacgacacggcaaaggggaggcagaacatctcgccggac
aagatcccgtggtccgccctgaagaccttgatggcccagtccatctacggcgggcgagtg
gacaatgagttcgaccagcgcctgctcaacactttcctggagcgcctgttcaccacgaag
agcttcgacagtgagttcaagctggcctgcaaggtcgacgggcacaaggacatccagatg
ccggacggcatcaggcgcgaggagttcgtgcagtgggtggagctgctccccgacgcccag
acgccgtcctggctgggcctgcccaacaacgccgagagggtcctcctcaccacccagggt
gtggacatgatcagcaagatgctgaagatgcagatgctggaggatgaggacgacctggcc
tacgccgaggccgagaagaaggcgaggacagactccacgtcagacggccgccccgcctgg
atgaggacgctgcacaccaccgcctccaactggctgcacctcatccctcagacgctgagc
cacctgaaacggacggtggacaacatcaaggatcctctgttcagattttttgagagagaa
gtgaagatgggagcgaagttactgcaggacgttcgccaggatcttgccgacgtcgtccaa
gtgtgtgaaggaaagaagaaacagaccaactacctgcgcacgctcatcaacgagctggtg
aaaggcatcttgcctcggagctggtcccactacacggtgcccgcgggcatgaccgtgatc
cagtgggtgtccgacttcagcgagaggatcaaacagctgcagaacatctccctggcggct
gcgtctggcggtgccaaggagctaaagaacatccacgtgtgtctgggcggcctgtttgtg
cctgaggcgtacatcaccgccaccaggcagtacgtggcccaggccaacagctggtccctg
gaggagctctgcctggaggtcaatgtcaccacctcgcagagtgctgccctcgacgcctgc
agcttcggtgtcacgggtctgaagctgcagggggccacgtgcagtaacaacaagctctcg
ctctccaacgccatctccaccgtcctcccgctgacgcagctgcgctgggtcaagcagacc
aacgccgagaggaaggccagcgtggtgaccctgcccgtctacctgaacttcacccgtgca
gacctcatcttcacggtggactttgaaatcgccaccaaggaggacccacgcagcttctac
gagcgcggcgtcgctgtcctctgcaccgagtga

DBGET integrated database retrieval system