KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499585
Entry
107499585         CDS       T06036                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01523  Antifolate resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04062  Chemokine signaling pathway
ray04064  NF-kappa B signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04380  Osteoclast differentiation
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04622  RIG-I-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04625  C-type lectin receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04668  TNF signaling pathway
ray04920  Adipocytokine signaling pathway
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05212  Pancreatic cancer
ray05215  Prostate cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05222  Small cell lung cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05340  Primary immunodeficiency
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107499585 (IKBKG)
   04014 Ras signaling pathway
    107499585 (IKBKG)
   04064 NF-kappa B signaling pathway
    107499585 (IKBKG)
   04668 TNF signaling pathway
    107499585 (IKBKG)
   04151 PI3K-Akt signaling pathway
    107499585 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107499585 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107499585 (IKBKG)
   04621 NOD-like receptor signaling pathway
    107499585 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    107499585 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    107499585 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    107499585 (IKBKG)
   04660 T cell receptor signaling pathway
    107499585 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    107499585 (IKBKG)
   04659 Th17 cell differentiation
    107499585 (IKBKG)
   04657 IL-17 signaling pathway
    107499585 (IKBKG)
   04662 B cell receptor signaling pathway
    107499585 (IKBKG)
   04062 Chemokine signaling pathway
    107499585 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107499585 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107499585 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107499585 (IKBKG)
   05203 Viral carcinogenesis
    107499585 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107499585 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107499585 (IKBKG)
   05221 Acute myeloid leukemia
    107499585 (IKBKG)
   05220 Chronic myeloid leukemia
    107499585 (IKBKG)
   05215 Prostate cancer
    107499585 (IKBKG)
   05222 Small cell lung cancer
    107499585 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    107499585 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107499585 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107499585 (IKBKG)
   05135 Yersinia infection
    107499585 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107499585 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    107499585 (IKBKG)
   05162 Measles
    107499585 (IKBKG)
   05164 Influenza A
    107499585 (IKBKG)
   05161 Hepatitis B
    107499585 (IKBKG)
   05160 Hepatitis C
    107499585 (IKBKG)
   05168 Herpes simplex virus 1 infection
    107499585 (IKBKG)
   05163 Human cytomegalovirus infection
    107499585 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107499585 (IKBKG)
   05169 Epstein-Barr virus infection
    107499585 (IKBKG)
   05165 Human papillomavirus infection
    107499585 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107499585 (IKBKG)
   05142 Chagas disease
    107499585 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107499585 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107499585 (IKBKG)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   107499585 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10
Other DBs
NCBI-GeneID: 107499585
NCBI-ProteinID: XP_015979392
LinkDB
Position
Unknown
AA seq 419 aa
MSRPPWKSQPCEMVQPSGGPAGDQDMLGEESSLGKPTMLHLPSEQGTPETFQRCLEENQE
LRDAIRQSNQMLRECCEELQRFQGNQREEKQFLMQKFQEARKLVERLSVEKLDLREQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALESRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQNQSMDAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDNHMKSSMVSSERNRGTQLEELKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSRLKASCQESARIEDMRKRH
VEVSQPPLIPAPAHHSSHLVLPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtcagccgtgtgagatggtgcagcccagcggtggcccg
gccggggaccaggacatgctgggtgaagagtcttctctggggaagccgaccatgctccac
ctgccttcggagcagggcactcctgagaccttccagcgctgtctggaggagaatcaggag
ctccgagatgccatccgccagagcaaccagatgctgcgggagtgctgtgaggagctgcag
cgtttccaaggcaaccagagggaggagaagcagttcctcatgcagaagttccaggaggcc
aggaaactggtggagagactgagtgtggagaagctcgacctgagggagcagagggagcag
gccctgcaggaggtggagcacctgaagaggtgccagcagcagatggccgaggacaaggcc
tcggtgaaggcccaggtgacatcgttgctaggggagctccaagagagccagagtcgcctg
gaagctgccaccaaggagcgacaggctttggagagcagggcccgggcggccagcgagcag
gcccggcagctggagagcgagcgcgaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagaaccaaagcatggacgccgccttgcgcatggagcgccaggccgcc
tcggaggagaagcggaagctggcccagctgcaggtggcctatcaccagctcttccaagag
tatgacaaccacatgaagagcagcatggtgagcagtgagcgaaaccgaggaacgcagctg
gaagagctcaagcagcagctgcagcaggccgaggaggccctggtggccaaacaggaagtg
atcgacaagctgaaggaagaggccgagcagcacaagattgtgatggagaccgttccggtg
ctgaaggcccaggcggatatctacaaggcagacttccaggccgagaggcaggcccgggag
aagctggccgagaagaaggagctcctgcaggaacagctggagcagctgcagcgggagtat
agcaggttgaaggccagctgtcaggagtcggccaggattgaagatatgaggaagcggcac
gtagaggtctcccagccccccttgatccctgccccagctcaccactcctctcacctggtc
ctgcccagccagaggaggagcccgcccgaggagccgcctgacttctgttgccccaagtgc
cagtatcaggcccctgatatggacaccctgcagatacacgtcatggagtgcattgagtag

DBGET integrated database retrieval system