KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499586
Entry
107499586         CDS       T06036                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04114  Oocyte meiosis
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04720  Long-term potentiation
ray04724  Glutamatergic synapse
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05152  Tuberculosis
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107499586 (PPP3R2)
   04310 Wnt signaling pathway
    107499586 (PPP3R2)
   04370 VEGF signaling pathway
    107499586 (PPP3R2)
   04020 Calcium signaling pathway
    107499586 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    107499586 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107499586 (PPP3R2)
   04218 Cellular senescence
    107499586 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107499586 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    107499586 (PPP3R2)
   04660 T cell receptor signaling pathway
    107499586 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    107499586 (PPP3R2)
   04659 Th17 cell differentiation
    107499586 (PPP3R2)
   04662 B cell receptor signaling pathway
    107499586 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107499586 (PPP3R2)
   04921 Oxytocin signaling pathway
    107499586 (PPP3R2)
   04924 Renin secretion
    107499586 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107499586 (PPP3R2)
   04720 Long-term potentiation
    107499586 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    107499586 (PPP3R2)
   04380 Osteoclast differentiation
    107499586 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107499586 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107499586 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    107499586 (PPP3R2)
   05020 Prion disease
    107499586 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    107499586 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    107499586 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107499586 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107499586 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    107499586 (PPP3R2)
   05163 Human cytomegalovirus infection
    107499586 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107499586 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107499586 (PPP3R2)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107499586 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107499586
NCBI-ProteinID: XP_015979388
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPEEMCSHFDNDEIKRLSKSFKKLDLDSSGTLSVDEFLSLSELQQNPLVQRVIE
VFDTDGNGEVDFKEFILGTSQFSVKGDKEQKLRFAFNIYDIDRDGYISNGELFQVLKMMV
GENLEDWQLQQLVDKTIIILDTDGDGKISFEEFSAVVGGLEIHKQLVVIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggccagttacccggaggagatgtgctcccacttcgacaacgatgaaatt
aaaaggttaagcaagagttttaagaagctggacttggactcttcggggactctgagcgtg
gacgagttcttgtccctgtccgagctgcagcagaacccgctggtgcagcgagtgatcgag
gtctttgacaccgacggcaacggagaagtggacttcaaggaattcatcttggggacctcc
cagttcagtgtcaagggggacaaggagcagaagctaaggtttgctttcaacatctacgac
atagatagagacggctacatttccaacggggagctcttccaggtgctgaagatgatggtg
ggggaaaacctggaagactggcagttacagcagctggtggacaaaaccatcatcatcctg
gatacggacggcgatgggaaaatatccttcgaggaattcagtgctgtcgtcggaggcctg
gagatccacaagcagctggtggtaattgtgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506933
Entry
107506933         CDS       T06036                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04114  Oocyte meiosis
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04720  Long-term potentiation
ray04724  Glutamatergic synapse
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05152  Tuberculosis
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107506933 (PPP3R1)
   04310 Wnt signaling pathway
    107506933 (PPP3R1)
   04370 VEGF signaling pathway
    107506933 (PPP3R1)
   04020 Calcium signaling pathway
    107506933 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    107506933 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107506933 (PPP3R1)
   04218 Cellular senescence
    107506933 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107506933 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    107506933 (PPP3R1)
   04660 T cell receptor signaling pathway
    107506933 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    107506933 (PPP3R1)
   04659 Th17 cell differentiation
    107506933 (PPP3R1)
   04662 B cell receptor signaling pathway
    107506933 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107506933 (PPP3R1)
   04921 Oxytocin signaling pathway
    107506933 (PPP3R1)
   04924 Renin secretion
    107506933 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107506933 (PPP3R1)
   04720 Long-term potentiation
    107506933 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    107506933 (PPP3R1)
   04380 Osteoclast differentiation
    107506933 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107506933 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107506933 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    107506933 (PPP3R1)
   05020 Prion disease
    107506933 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    107506933 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    107506933 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107506933 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107506933 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    107506933 (PPP3R1)
   05163 Human cytomegalovirus infection
    107506933 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107506933 (PPP3R1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107506933 (PPP3R1)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     107506933 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 107506933
NCBI-ProteinID: XP_015993364
LinkDB
Position
Unknown
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttaccctttggaaatgtgctctcactttgatgctgatgaaatt
aaaaggctagggaagagatttaagaagcttgatttggacaattctggttctttgagcgtg
gaagagttcatgtctctgccggagttacaacagaatccattagtacagcgggtcatagat
atattcgacacagatgggaatggagaagtagactttaaagaattcattgagggagtctct
cagttcagtgtcaaaggcgataaggaacagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509227
Entry
107509227         CDS       T06036                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04114  Oocyte meiosis
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04720  Long-term potentiation
ray04724  Glutamatergic synapse
ray04728  Dopaminergic synapse
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05152  Tuberculosis
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107509227 (PPP3CC)
   04310 Wnt signaling pathway
    107509227 (PPP3CC)
   04370 VEGF signaling pathway
    107509227 (PPP3CC)
   04020 Calcium signaling pathway
    107509227 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    107509227 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107509227 (PPP3CC)
   04218 Cellular senescence
    107509227 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107509227 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    107509227 (PPP3CC)
   04660 T cell receptor signaling pathway
    107509227 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    107509227 (PPP3CC)
   04659 Th17 cell differentiation
    107509227 (PPP3CC)
   04662 B cell receptor signaling pathway
    107509227 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107509227 (PPP3CC)
   04921 Oxytocin signaling pathway
    107509227 (PPP3CC)
   04924 Renin secretion
    107509227 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    107509227 (PPP3CC)
   04728 Dopaminergic synapse
    107509227 (PPP3CC)
   04720 Long-term potentiation
    107509227 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    107509227 (PPP3CC)
   04380 Osteoclast differentiation
    107509227 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107509227 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107509227 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    107509227 (PPP3CC)
   05020 Prion disease
    107509227 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    107509227 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    107509227 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107509227 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107509227 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    107509227 (PPP3CC)
   05163 Human cytomegalovirus infection
    107509227 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107509227 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107509227 (PPP3CC)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107509227 (PPP3CC)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107509227 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 107509227
NCBI-ProteinID: XP_015997066
LinkDB
Position
Unknown
AA seq 525 aa
MSGRNLHLSTTERVIKAVPFPPTQRLTLKEVFENGKPKIDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEQVYEACMDTFDC
LPLAALLNQQFLCVHGGMSPEITCLDDIRKLDRFKEPPAFGPVCDLLWSDPSEDYGSEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISEDELEGGTTVRKEIIKNKIRAIGKMARVFSILREESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHRIRSFEEARGLDRINERMPPR
KDSQYSDGPVKLAAPVQSNAALRSDKGRRASSDSEPGCGAGGPTT
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgtccgggaggaacctccacctctccaccaccgaacgcgtcatcaaagctgtccccttt
cctccaacccaacggcttactttgaaggaagtgtttgagaatgggaaacctaaaatagat
gttttaaaaaaccatttggtgaaagaagggcgactggaagaggaagtagccttaaagata
attaacgatggggctgccatcctgagacaagagaagactatgatagaagtcgatgctcca
atcacggtgtgtggtgacattcatggacagttctttgacctgatgaagttgtttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtactgtatttatggagtttaaagataaaccatcccaaaacgttg
tttctgcttcggggaaatcatgaatgcaggcatcttacagaatatttcaccttcaaacag
gaatgtcgaatcaaatattctgagcaggtgtatgaggcttgtatggatacctttgattgt
cttcctcttgctgccctcttaaatcagcagtttctgtgtgtccatggagggatgtcacct
gaaattacttgtttagatgatattaggaaattagacaggtttaaagaacctccagccttt
gggccggtgtgtgacctgctttggtccgacccctccgaggactacggcagtgaaaagacc
ttggagcactatacccacaacacggtccgagggtgctcttatttttacagttaccccgca
gtttgtgaatttttgcagaataataatttgttatcaataatcagagcccatgaagcccaa
gatgctgggtaccgaatgtacaggaagagccaaacaacaggctttccatccctcattaca
attttctctgcccccaattacctagatgtctacaacaataaagctgctgtgttaaaatac
gaaaacaacgtcatgaatatcaggcagtttaactgttctccacacccctactggcttcca
aacttcatggatgttttcacatggtctttgccttttgttggggaaaaagtcacagagatg
ctggttaacattctcaacatatgctctgatgatgaattgatttccgaagatgaacttgaa
ggcggcactacggttcgaaaggagatcatcaagaataaaatcagagccattgggaagatg
gcacgggtcttttcaattcttcgggaagaaagtgagagtgtgctgactctcaaaggcctg
acccccacaggtaccctccctctgggtgtcctctccggagggaagcagactattgagaca
gccacagtagaagccgtagaggcccgggaagctatcagagggttttcgcttcagcacagg
atccggagttttgaagaagcccgaggtctggaccgaattaatgagcggatgccaccccga
aaagacagccagtactccgacgggccagtgaaactggccgcccctgtgcagtcaaacgct
gcgctcaggagcgacaaggggagaagggccagcagcgactccgagcccggctgtggcgca
ggcggccccacaacctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516843
Entry
107516843         CDS       T06036                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04114  Oocyte meiosis
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04720  Long-term potentiation
ray04724  Glutamatergic synapse
ray04728  Dopaminergic synapse
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05152  Tuberculosis
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107516843 (PPP3CB)
   04310 Wnt signaling pathway
    107516843 (PPP3CB)
   04370 VEGF signaling pathway
    107516843 (PPP3CB)
   04020 Calcium signaling pathway
    107516843 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    107516843 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107516843 (PPP3CB)
   04218 Cellular senescence
    107516843 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107516843 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    107516843 (PPP3CB)
   04660 T cell receptor signaling pathway
    107516843 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    107516843 (PPP3CB)
   04659 Th17 cell differentiation
    107516843 (PPP3CB)
   04662 B cell receptor signaling pathway
    107516843 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107516843 (PPP3CB)
   04921 Oxytocin signaling pathway
    107516843 (PPP3CB)
   04924 Renin secretion
    107516843 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    107516843 (PPP3CB)
   04728 Dopaminergic synapse
    107516843 (PPP3CB)
   04720 Long-term potentiation
    107516843 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    107516843 (PPP3CB)
   04380 Osteoclast differentiation
    107516843 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107516843 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107516843 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    107516843 (PPP3CB)
   05020 Prion disease
    107516843 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    107516843 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    107516843 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107516843 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107516843 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    107516843 (PPP3CB)
   05163 Human cytomegalovirus infection
    107516843 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107516843 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107516843 (PPP3CB)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107516843 (PPP3CB)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107516843 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 107516843
NCBI-ProteinID: XP_016012487
LinkDB
Position
Unknown
AA seq 480 aa
MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFF
DLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHL
TEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEVHTLDDIRRLD
RFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNC
SPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEI
IRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAE
KAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHSAQ
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggatgggatacctagggttgatgttctgaagaaccacttagtaaaagaaggtcgggta
gatgaagaaattgcacttagaattatcaatgagggtgctgccatccttcggagagagaaa
accatgatagaagtagaggctccaattacagtgtgtggtgacatccatggccaatttttt
gatctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttctt
ggtgattatgtggacagaggttattttagtatagagtgtgtcttatatttatgggtcctg
aagattctatacccaagcacattatttcttctaagaggcaatcatgaatgcagacacctt
actgaatattttacctttaagcaggaatgtaaaattaaatattcagaaagagtctatgaa
gcttgtatggaagcttttgatagcctgcctcttgctgcacttttaaatcaacaatttctt
tgtgttcatggtggactttcaccagaagtacacacactggatgatattaggagattagat
agattcaaagagccacctgcatttggaccaatgtgtgacttgctatggtccgatccttct
gaagattttggaaatgaaaaatcacaggaacattttagtcacaatacagttcgaggatgt
tcttatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcg
attattagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaact
acagggttcccttcattaataacaattttttcggcacctaattacttagatgtctacaat
aataaagctgctgtattaaagtatgaaaataatgtgatgaatattcgacagtttaactgt
tctccacatccttactggttgcccaattttatggatgtcttcacatggtctttaccattt
gttggagagaaagtgacagaaatgttggttaatgttctgagtatttgctctgatgatgaa
ctgatgactgaaggtgaagaccagtttgatgtaggttcagctgcagcccggaaagaaatc
ataagaaacaaaattcgagcaattggcaagatggcaagggtcttctctgttctcagggag
gagagtgaaagtgtgctgacactcaagggcctgactcccacagggatgttgcctagtgga
gtgttggctggaggacggcagaccctgcaaagtgccacagttgaggctattgaggctgaa
aaagcaatacgaggattctctccaccacatagaatctgcagttttgaagaggcaaagggt
ttggataggatcaatgagagaatgccaccccggaaagatgctgtacagcaagatggtttc
aattctctgaacaccgcacatgccactgagaaccacgggactggcaaccatagtgcccag
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517885
Entry
107517885         CDS       T06036                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04114  Oocyte meiosis
ray04218  Cellular senescence
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04380  Osteoclast differentiation
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04720  Long-term potentiation
ray04724  Glutamatergic synapse
ray04728  Dopaminergic synapse
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05152  Tuberculosis
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107517885 (PPP3CA)
   04310 Wnt signaling pathway
    107517885 (PPP3CA)
   04370 VEGF signaling pathway
    107517885 (PPP3CA)
   04020 Calcium signaling pathway
    107517885 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    107517885 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107517885 (PPP3CA)
   04218 Cellular senescence
    107517885 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107517885 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    107517885 (PPP3CA)
   04660 T cell receptor signaling pathway
    107517885 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    107517885 (PPP3CA)
   04659 Th17 cell differentiation
    107517885 (PPP3CA)
   04662 B cell receptor signaling pathway
    107517885 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    107517885 (PPP3CA)
   04921 Oxytocin signaling pathway
    107517885 (PPP3CA)
   04924 Renin secretion
    107517885 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    107517885 (PPP3CA)
   04728 Dopaminergic synapse
    107517885 (PPP3CA)
   04720 Long-term potentiation
    107517885 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    107517885 (PPP3CA)
   04380 Osteoclast differentiation
    107517885 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107517885 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107517885 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    107517885 (PPP3CA)
   05020 Prion disease
    107517885 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    107517885 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    107517885 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107517885 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107517885 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    107517885 (PPP3CA)
   05163 Human cytomegalovirus infection
    107517885 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107517885 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107517885 (PPP3CA)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107517885 (PPP3CA)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     107517885 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 107517885
NCBI-ProteinID: XP_016014519
LinkDB
Position
Unknown
AA seq 521 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataatgatgggaaa
cctcgtgtggatatcttaaaggcacatctcatgaaggaaggcaggctggaagagagtgtg
gcattgagaataataacagagggagcttcaattcttcgacaggaaaaaaatttgctggat
attgatgcaccagtcacagtttgtggggacatccatggacagttttttgacttgatgaag
ctctttgaagtggggggatctcctgccaacacccgctacctcttcttaggggactatgtg
gacagagggtacttcagcatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttactccgtggaaatcatgaatgtagacatctaacagaatatttc
acatttaaacaagaatgtaaaataaaatattcagaacgtgtctatgatgcctgtatggac
gcctttgactgcctgcctttggctgccctgatgaaccagcagttcctgtgtgtacatggt
ggtctatctccagagattaacactttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcttatggacccatgtgtgatatcttgtggtcagaccccctggaggactttggc
aatgagaagactcaggaacattttactcacaacacagtcaggggatgttcgtacttctac
agttacccagctgtttgtgaattcttacagcacaataacttgttatctatactccgagcc
catgaagcccaagatgcagggtatcgcatgtacaggaaaagccaaacaacaggcttccct
tctctaattacaattttttcagcaccaaattacttagatgtatacaataacaaagctgcg
gtattgaagtatgagaacaatgtcatgaatatcaggcaattcaactgttctcctcatcct
tactggcttccaaatttcatggatgttttcacttggtccctgccatttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagatgatgaacttgggtcagaa
gaagatggatttgatggagccacagctgctgcccggaaggaggtgataaggaacaagatc
cgagcaataggcaaaatggccagagtgttctcggttctcagagaagagagtgagagcgtg
ctgacgctgaaaggcctgacccccacaggcatgctccccagcggagtgctttctggaggg
aagcaaacactgcaaagcgctactgttgaggctattgaggctgatgaagctatcaaagga
ttttcaccacaacataagatcactagcttcgaggaggccaagggcttagaccgaattaac
gagaggatgccacctcgcagagatgccatgccctctgacgccaaccttaactccatcaac
aaggccctcgcctcagagactaacggcacggacagcaatggcagtaatagcagcaatatt
cagtga

DBGET integrated database retrieval system