KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499591
Entry
107499591         CDS       T06036                                 

Gene name
SCN5A
Definition
(RefSeq) sodium channel protein type 5 subunit alpha
  KO
K04838  voltage-gated sodium channel type V alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107499591 (SCN5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107499591 (SCN5A)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   107499591 (SCN5A)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc Na_trans_cytopl PKD_channel GPHH IQ
Other DBs
NCBI-GeneID: 107499591
NCBI-ProteinID: XP_015979402
LinkDB
Position
Unknown
AA seq 2015 aa
MADFLLPRGTSSFRRFTRESLAAIEKRMAEKQARGLATSQESRDGLPEEEAPRPQLDLQA
SKKLPDLYGNPPRELLGEPLEDLDPYYSTQKTFIVLNKGKTIFRFSATNALYVLSPFHPV
RRAAVKILVHSLFSMLIMCTILTNCVFMAQHDPPPWTKYVEYTFTAIYTFESLVKILARG
FCLHAFTFLRDPWNWLDFSVIVMAYTTEFVDLGNVSALRTFRVLRALKTISVISGLKTIV
GALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTELNGTNGSVEADGLV
WDSLDLYLNDPENYLLKNGTSDVLLCGNSSDAGTCPEGYRCLKAGENPDHGYTSFDSFAW
AFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQN
QATIAETEEKEKRFQEAMEMLKKEHEALTIRGVDTVSRSSLEMSPLALVTTHERRSKRRK
RMSSGTEECGDERFPKSDSEDGLRAMNRLSLTHGLSRASMKPRSSRGSIFTFRRRDLGSE
TDFADDENSTAGDSESHRTSLLVPWPLRRPSAQAQPSPGTSGLGHALNGKRNSTVDCNGV
VSLLGTGDPEATSPGSHLLRPMTLERPPDTTTPSEEAGRPQMLSPQAPCVDGFEGPRERQ
RALSAVSVLTSALEELEESHRKCPPCWNRFAQRYLIWECCPLWISIKQKVKFMVMDPFAD
LTITMCIVLNTLFMALEHYNMTTEFEEMLQVGNLVFTGIFTAEMTFKIIALDPYYYFQQG
WNIFDSIIVILSLMELGLSRMGNLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALG
NLTLVLAIIVFIFAVVGMQLFGKNYSELRHRISDSGLLPRWHMMDFFHAFLIIFRILCGE
WIETMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAPDEDGEMNN
LQLALARIQRGLRFLKRTTWDFCCGLLQRRPRKPVVLATRGQLPNCVATSSSPPPPETEK
VPPARKETRFEESKHPGQGTPGDPEHVCVPIAVAESDTDDQEEDEENSLGTEEESSKQQE
PQPASGGPEALPEPRAWSQVSETASSEAEASAAQADWQQQRKVEPQAPGYSETHEDSYSE
GSTADMTNTADLLEQIPDLGEDVQDPEDCFTEGCVRRCPCCAVDTTRAPGKVWWRLRKTC
YRIVEHSWFESFIIFMILLSSGALAFEDIYLEERKTIKVLLEYADKMFTYVFVLEMLLKW
VAYGFKKYFTNAWCWLDFLIVDVSLISLVANTLGFAEMGPIKSLRTLRALRPLRALSRFE
GMRGLVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLNYTIVNNKS
DCESFNVTGELYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYEEQPQWEY
NLYMYIYFVVFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLG
SKKPQKPIPRPLNKYQGFVFDIVTKQAFDVTIMFLICLNMVTMMVETDDQSPEKVNILAK
INLLFVAIFTGECIVKMAALRHYYFTNSWNIFDFVVVILSIVGTVLSDIIQKYFFSPTLF
RVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMANFAYV
KWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPNLPNSNGSRGNC
GSPAVGILFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEKFD
PEATQFIEYSALSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVL
GESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSATIIQRAFRRHLLQRSVK
HASFLFRQQTGSSGLSEADAPEREGLIAYMMNKNFSQSLGPPSSSSISSTSFPPSYDSVT
RATSDNLQVRVSDYSRSEDLADFPPSPDRDRESIV
NT seq 6048 nt   +upstreamnt  +downstreamnt
atggcagacttcctgttacctcggggcaccagcagcttccgcaggttcacccgggagtcc
ctggcagccatcgagaagcgcatggcggagaagcaagcccgaggcttggccacctcgcag
gagagccgtgacgggctgcccgaggaggaggctccccggccccagctggacctgcaggcc
tccaaaaagctgccagacctctatggcaacccgccccgagagctcctcggggagcccctg
gaggacctggacccctactacagcacccagaagaccttcatcgtgctgaataaaggcaag
accatcttccggttcagtgccaccaacgccttgtatgtcctcagtcccttccaccccgtc
cggagagcggctgtgaagattctggttcattcgctctttagcatgctcatcatgtgcacc
atcctgaccaactgcgtgttcatggcccagcatgaccctccaccctggaccaagtatgtc
gagtacaccttcactgccatttacacctttgagtctctggtcaagattctggctcgaggc
ttctgcctgcacgcattcaccttccttcgggacccgtggaactggctggacttcagcgtg
attgtcatggcatacacaactgaatttgtggacctgggcaatgtctcagctttacgcacc
ttccgagtcctccgggccctgaaaactatatcggtcatttcaggcctgaagaccatcgtg
ggggccctgatccagtccgtgaagaagctggccgacgtgatggtcctcacggtcttctgc
ctcagcgtcttcgccctcatcggcctgcagctcttcatgggcaacctgaggcacaagtgc
gtgcgcaacttcacggagctcaacggtaccaacggctccgtggaggccgatggcctggtc
tgggactcgctggacctctacctcaacgatccagaaaattacctgcttaagaatggcacc
tccgatgtgttactgtgcgggaacagctctgacgccgggacatgtcctgagggctaccgg
tgcctaaaggcaggagagaaccctgaccacggctacaccagctttgactccttcgcctgg
gccttcctcgcgctctttcgcctgatgacacaggactgctgggagcgcctctatcagcag
accctgaggtccgcagggaagatctacatgatattcttcatgcttgtcatcttcctgggt
tccttctacctggtgaacctgatcctggctgtggtcgctatggcctatgaggagcaaaac
caagccaccatcgccgagaccgaggaaaaagaaaagcgattccaggaggccatggagatg
ctcaagaaagaacatgaggccctcaccatcaggggtgtggacaccgtgtcccgcagctcc
ttggagatgtcccctttggccctagtaaccacccacgagagaaggagcaagaggagaaaa
cgaatgtcttcggggacagaggagtgtggggatgagaggttccccaagtccgactcggag
gatggcctcagagcaatgaatcgtctcagcctcacccacggcctcagcagggcctctatg
aagccacgctccagccgcgggagcattttcacctttcgccggcgagacctgggttccgag
acagattttgcagatgacgaaaacagcacggcaggggacagcgagagccaccgcacgtca
ctgctggtgccctggcccctgcgccggcctagtgcccaggcacagcccagtcccgggacc
tcaggccttggccacgccctcaatggcaaaaggaacagtactgtggactgcaatggggtg
gtctctttgctggggacaggcgaccccgaggccacctccccagggagccacctccttcgc
cctatgacgctggagcgccccccagacacgaccacaccgtcggaggaggcaggcaggccc
cagatgctgagcccccaggctccgtgtgtggatggcttcgaagggccaagggagcggcag
cgggccctcagcgccgtcagcgtcctcaccagcgccctggaagagctggaggagtctcac
cgcaagtgtccgccgtgctggaaccgcttcgcccagcgctacctgatctgggagtgctgc
ccattgtggatctccattaagcagaaagtgaagttcatggtcatggacccatttgctgac
ctcaccatcaccatgtgcatcgtgcttaacacactcttcatggcactggagcactacaac
atgacaactgaattcgaggagatgctgcaggtcggaaacctggtcttcacagggatcttc
acagcagagatgaccttcaagatcatcgctctcgacccttactactacttccagcagggc
tggaatatcttcgacagcatcattgtcatccttagcctcatggagctgggcctgtcccgc
atgggcaacctgtcggtgctgcgttccttccgcctgctgcgggtcttcaagctggccaag
tcatggcccaccctgaacacactcatcaagatcatcgggaattcggtgggggctctgggg
aacctgacgctggtgctggccatcatcgtgttcatcttcgccgtggtgggcatgcagctc
tttgggaagaactactcagagctgaggcatcgcatcagcgactcgggcctgctgccccgc
tggcacatgatggacttcttccatgcctttctcatcatcttccgcatcctctgtggcgag
tggatagagaccatgtgggactgcatggaggtgtctgggcagtcactgtgcctgctggtg
ttcttgctcgtaatggtcattggcaaccttgtggtcctgaacctcttcctggctttgctg
ctcagctccttcagtgcagacaacctcacagcccctgatgaggacggggaaatgaacaac
ctccagctggccctggcccgcatccagcggggcctgcgtttcctcaagcgaaccacctgg
gacttctgctgtgggctcctgcagcggcggcctcggaagccggtggtcctcgccacccga
ggccagctgcccaactgtgttgctacctccagctctccaccaccccctgagacagagaag
gttcctccagcccgcaaggagacccggtttgaggaaagcaagcatccaggccagggcacc
cctggggatcctgagcatgtgtgtgtacccattgccgtggctgagtcggacacagatgac
caagaggaggacgaagagaacagcctgggcacagaggaagagtccagcaagcagcaggaa
ccccagcctgcgtccggcggcccagaggccctcccggagcccagggcctggagccaggtg
tcagagaccgcctcctccgaggccgaggccagtgcggctcaggcagactggcagcagcag
cggaaagtggagccccaggccccagggtacagtgagacccacgaggacagttactccgag
gggagcacggcagacatgaccaatactgccgacctcctggagcagatccccgacctcggc
gaggacgtccaggacccggaggactgcttcacggaaggctgtgtccggcgctgtccctgc
tgtgctgtggacaccacacgggccccagggaaagtctggtggcggctgcgcaagacctgc
taccgcatcgtggagcacagctggttcgagagcttcatcatcttcatgatcctgctcagc
agcggagcgctggccttcgaggacatctacctggaggagcggaagaccatcaaggttctg
ctcgagtacgccgacaagatgttcacctacgtcttcgtgctggagatgctgctcaagtgg
gtggcctatggcttcaagaagtacttcaccaacgcctggtgctggctggacttcctcatc
gtggatgtctcgctcatcagcctggtggccaacaccctgggcttcgctgagatgggcccc
atcaagtcactgcggacactgcgtgcgctccgacccctgcgagccctgtcacgatttgaa
ggcatgaggggcctggtaggcgccatcccgtccatcatgaacgtcctcctcgtctgcctc
atcttctggctcatcttcagcatcatgggtgtgaacctctttgcgggcaagtttgggagg
tgcatcaaccagactgagggggacctacctttgaactacaccattgtaaacaacaagagt
gactgtgagtctttcaacgtgactggcgaattgtactggaccaaggtgaaagtcaacttt
gacaacgtgggggccgggtacctggcccttctgcaggtggcaacatttaaaggctggatg
gacattatgtatgcagctgtggactccagggggtatgaagagcagccccagtgggagtac
aacctctacatgtacatctacttcgtcgtgttcatcatcttcgggtctttcttcaccctg
aaccttttcatcggtgtcatcattgacaacttcaaccagcagaagaaaaagttagggggc
caggacatcttcatgacagaggagcagaagaagtactacaacgccatgaagaagctgggc
tccaagaagccccagaagcccatcccgaggcctctgaacaagtaccagggcttcgtcttc
gacattgtgaccaagcaggccttcgacgtcaccatcatgtttctcatctgcttgaacatg
gtgacgatgatggtggagacggatgaccagagccccgagaaggtcaacatcttggccaag
atcaacctactcttcgtagccatcttcacgggcgagtgcatcgtcaagatggccgccctg
cgccactattacttcaccaacagctggaacatcttcgacttcgtggtcgtcatcctctcc
atcgtgggcacggtgctctcagacatcatccagaagtacttcttctccccaacgctcttc
cgagtcatccgcctggcccggatcggccgcatcctcaggctgatccgcggggccaagggg
atccgcacgctgctcttcgccctcatgatgtccctgcccgccctcttcaacatcgggctg
ctgctcttcctcgtcatgttcatctactccatcttcggcatggccaacttcgcctacgtc
aagtgggaggccggcatcgacgacatgttcaatttccagaccttcgccaacagcatgctg
tgcctcttccagatcaccacgtcggccggctgggatggtctcctcagccccatcctcaac
acggggcccccctactgcgaccccaatctgcccaacagcaacggctcccgggggaactgc
gggagccccgccgtgggcatcctcttcttcaccacctacatcatcatctccttcctcatc
gtggtcaacatgtacatcgccatcatcctggagaacttcagtgtggccacagaggagagc
acggagcccctgagcgaggacgactttgacatgttctatgagatctgggagaagttcgac
cccgaggccacccagttcatcgagtattcggccctgtccgacttcgccgatgccctgtct
gagccgctccgcatcgccaagcccaaccagataagcctcatcaacatggacctgcccatg
gtgagcggggaccgtatccactgcatggacatcctcttcgccttcaccaagagggtcctg
ggtgagtcgggggagatggacgccctgaagatccagatggaggagaagtttatggcggcc
aacccatccaagatctcctacgagcccatcaccaccacgctgcggcgcaagcacgaggag
gtgtcagccacgatcatccagcgggccttccggaggcacctgctgcaacgctccgtgaag
cacgcctccttcctcttccgccagcagacgggcagcagcggcctctctgaggcagatgcc
cccgagcgagagggcctcatcgcctacatgatgaataagaacttctcccagagccttggc
ccgccctccagctcctctatctcctccacgtccttcccgccttcctatgacagcgtcacc
agggcaaccagtgataacctccaggtgcgggtgtctgactacagccgcagcgaagatctc
gcggacttccccccatccccggacagggaccgagagtccatcgtgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504253
Entry
107504253         CDS       T06036                                 

Gene name
SCN1B
Definition
(RefSeq) sodium channel subunit beta-1
  KO
K04845  voltage-gated sodium channel type I beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107504253 (SCN1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107504253 (SCN1B)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   107504253 (SCN1B)
SSDB
Motif
Pfam: V-set Ig_3
Other DBs
NCBI-GeneID: 107504253
NCBI-ProteinID: XP_015988834
LinkDB
Position
Unknown
AA seq 218 aa
METLLAFVVGAALVSSAWAGCVEVDSETEAVYGMTFKILCISCKRRSETTAETFTEWTFR
QKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYE
CHVYRLLFFENYEHNTSVVKKIHLEVVDKANRDMASIVSEIMMYVLIVVLTIWLVAEMVY
CYKKIAAATEAAAQENASEYLAITSESKENCTGVQVAE
NT seq 657 nt   +upstreamnt  +downstreamnt
atggagacactgctggccttcgtggtcggcgcggcgctggtgtcctcggcctgggcgggc
tgtgtggaagtggactcggagaccgaggccgtgtacggcatgaccttcaaaattctgtgc
atctcctgcaagcgccgcagcgagaccaccgccgagaccttcacagagtggaccttccgt
cagaagggcaccgaggagtttgtgaagatcctgcgctatgagaacgaggtgctacagctg
gaggaggatgagcgctttgagggccgtgtggtatggaatggcagccggggcaccaaggac
ctgcaggacctgtccatcttcatcaccaacgtcacctacaaccactcgggcgactacgag
tgccacgtctaccgtctgctctttttcgagaactatgagcacaacaccagcgtcgtcaaa
aagatccaccttgaggtagtggacaaagccaacagagacatggcgtccattgtgtctgag
atcatgatgtacgtgctcatcgtggtgttgaccatatggctcgtggctgagatggtttac
tgctacaagaagattgctgctgccacagaggctgccgcacaagaaaacgcctcggaatac
ctggccatcacctcagaaagcaaagagaattgtacgggtgtccaagtggccgaatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516119
Entry
107516119         CDS       T06036                                 

Gene name
SCN4B
Definition
(RefSeq) sodium channel subunit beta-4
  KO
K04848  voltage-gated sodium channel type IV beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107516119 (SCN4B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107516119 (SCN4B)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   107516119 (SCN4B)
SSDB
Motif
Pfam: V-set ig I-set Ig_3 Glycophorin_A Ig_2 Syndecan
Other DBs
NCBI-GeneID: 107516119
NCBI-ProteinID: XP_016011046
LinkDB
Position
Unknown
AA seq 228 aa
MPGDGDRGAARARWLGTGLLGLFLLPVSLSLEVSVGKAITIYAVNGTEILLPCTFSSCFG
FRDLGFWWSYNGSDTFKILINATVKNEKSDPKVHLKNDDRITLEGSTKEKMNNISILLKD
LDFSDTGKYTCHVKNPKEKDLQHQATIFLQVVDKLEEVDNTVTLIILAVVGGVIGLLIFI
LLVKKLITFILKKTQEKKKECLVSSSGNDNTENGLPGSKAEEKPPTKV
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcccggggatggggaccgaggcgcagcccgggcgagatggctgggcactgggcttttg
ggtctcttcctgctccccgtgtccctgtcgctggaggtgtctgtgggaaaggccatcact
atctacgccgtcaacggcacggagatcctgctgccctgcaccttctccagctgctttggc
ttccgtgaccttggcttctggtggtcctacaacggtagtgatacattcaagattctcata
aatgcaactgtaaagaatgagaagtctgaccccaaggtacatttgaaaaatgatgaccgc
atcactctggagggttccactaaggagaaaatgaacaatatttccattctgctaaaagat
ctggatttcagtgacacaggcaaatacacctgtcacgtgaagaatcccaaggagaaagat
cttcagcaccaggctaccatcttccttcaagtggttgacaaattggaagaagtggacaac
acagtgacactcatcatcctggctgtcgtgggtggcgttattgggctcctcatcttcatc
ttgttggtgaagaagctcatcaccttcatcctgaagaaaactcaggagaagaagaaggag
tgccttgtgagttcctctgggaatgacaatacggagaatgggttgccgggctccaaggca
gaagagaaaccaccaacaaaagtgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521052
Entry
107521052         CDS       T06036                                 

Gene name
SCN7A
Definition
(RefSeq) LOW QUALITY PROTEIN: sodium channel protein type 7 subunit alpha
  KO
K04839  voltage-gated sodium channel type VII alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107521052 (SCN7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107521052 (SCN7A)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   107521052 (SCN7A)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc GPHH
Other DBs
NCBI-GeneID: 107521052
NCBI-ProteinID: XP_016020920
LinkDB
Position
Unknown
AA seq 1674 aa
MASPEPMSLVPFTKESLELMEQRIAKKHNEEQQEDLKPNNDLEVGKKLPFIYGNLLQGTV
SEPLEDVDPYYQNKNTFIVINKKRTIFRFNAIWCTLSPFNSIRKTTIKILVHPFFRLFIL
MTVLTDCIYMSMTNLPKWGLALQNTLLGIYTLEILVKLTARGIWVGPFYFFGDPWNWLDF
TVTLFEHVISYSPVYFVSTFRIARNLRILKIVPLNQGLKTYLGILLRCLKKLTGVIILTL
FFLSVFSLIGMGLFMGNLKHKCLRWPQENETETLFNRTRNPHYLREIENFYHLEGERYAL
LCGNRTDAGQCPEGYVCVKAGTNPDDGYTNFDNFGWALLALFRLMTQDYPEALYHQILYA
SGKVYMMFFVVISFWFAFYMASLFLGIVAMSYEEEKQTAVEKAKKTEPENDHTLNELQEE
NEDTETQTTQIEMMKRSPAFMITSSNTLDDATIRYGEEHKKSQKRCPLYWCRFAKTFLTW
NCCPCWLKLKEFVHVIIMHPFTDLFLAICIILNIYFLTLECYPMNEETISALSIGNLVFI
GIFTGEMIFKIIAMHPYGYFQAGWNIFDSLIVFHGLAELFLVNVHGMALFRPFRVLRIFK
LGKYWPTFKILMLTLSNSLVALRNLILLLFTFMFFSAVVGMRLFGLNYKECVCSVDKDCQ
LPRWHMMDFFHSFLNVFRILCGEWIETLWDCFNVAGQFSCIPFYMMVILIGNLMIFYLFL
ALVSSFSSYNSATTEENDEAKNLQHAIARIKKAANYVLSKILCKKQNVPKEKMDNVNDTY
VKENISDHTLSELSNTQDFLKDKEKSSGTEKLTMTENESRSLIPSPSVSETVPIASGESD
IENLDNKETHSKSGYGSSKEKIKPSSSSECSTVDIAISEEEEMIYEHEKHPKNGYGRRSS
QGQISSESKRGKMWQNIRKTCCKIVENSFFKFFIGLVTLLSTGALAFEDIYIDQRKTIKI
LLEYADMIFTYVFILEMLLKWMAYGFKAYFTNGWYRLDFMVVIVFCLSLMGKSREELKPL
ISIKFLRALRVLSQFERMKVVVRALIKTTFPTLNVFLVCLVIWLAFSIVGVHLFAGKFYE
CIDPTSGGRFPIYEVRNKSQCESLVFNESMPWENAKLNFDNVGNGFLSLLQVATFNGWIT
IMNSAIDSIGVNMQPNFEDNIYMYYYFIGFIIFGLFLPLTMLTGVMIANFQKLKTKGGSN
IFITVKQKKQYRALKKLMYGDSQKPVPRPGNKFRGFIFDLVTNQIFNIIIMALICFQAIA
IMIQSDEQSPKMDAALYWINSVFVMLYTGECLLKLISFRCNYFTIGWNIFDFMVVIFSIT
GLLLPLMVGYYLVPPSLVQLILLSRIIHILRPGKGPKVFHDLLLPLMLSLPALLNISLLI
FLVMFIYAIFGMYNFAYVKKEAGINDVSNFETFGSSMLCLFQVTIFAGWDGMLNAVFNSK
WSDCDPDKINPGTQVRGDCGNPFVGIIYFVSYILISWLIIVNMYIVVVMELLNIASKKKI
KALSEDDFRKFFQVWQRFDPDKTQYIDSSKLSDFAAALDPPLFMAKPNKGQLVAMDLPMA
VGDRIHCFDILLAFSKRVMGTDMKIEKVLSEMESGFILANPFKITYEPITTTLKRKQEAV
SATIIQRAYKSYRLRQNDKNTSDIHMIDDDRNGQATXEDAYFDKAEEKTIQNYI
NT seq 5025 nt   +upstreamnt  +downstreamnt
atggcttccccagaacctatgagccttgtccctttcaccaaggagtcccttgaacttatg
gaacagcgtattgctaagaaacacaatgaggaacagcaagaagatttaaagccaaacaat
gacttggaagttggaaaaaagcttccattcatttatggaaatcttcttcaaggaactgtg
tcagagcccttggaagatgtggatccatactaccagaataaaaacactttcattgtaata
aataaaaagagaacaatcttcagattcaatgctatctggtgtacattgtctcctttcaat
tcaattagaaaaacaactattaagatattggtacatccctttttccgactgttcatttta
atgaccgtcctgactgactgcatatatatgtccatgactaatttgccaaaatgggggctg
gcattacagaatactttgcttggaatttacacacttgaaatacttgtaaaacttactgca
agaggcatctgggtaggacctttttatttctttggtgatccgtggaactggcttgatttc
actgtaactttgtttgagcatgtaataagctattcgcctgtatacttcgtttcgacattt
cgaattgcaagaaatttgagaattttgaaaattgtccctttgaaccaaggcctgaagact
tatctagggatcctgctccgttgtttgaaaaaactgactggtgtcattatccttactctg
ttttttctgagtgtattttctttaattggaatggggctcttcatgggcaacctgaagcat
aaatgtttgcgatggccccaagaaaatgaaacggaaaccctattcaacagaactagaaac
ccacattatcttcgagaaatagaaaacttctatcatttggaaggagaaagatatgctctc
ctttgtggcaacaggacagatgctggtcaatgtcctgaaggatatgtgtgtgtaaaagct
ggcacaaatccggatgatggctacacaaattttgacaattttggctgggctttattagct
ctattccggttaatgacacaggattaccctgaagcgctttatcaccagatcctttatgct
tctggaaaggtctacatgatgttttttgttgtaataagcttttggtttgccttttatatg
gcaagtttgttcttgggcatagttgctatgtcttatgaggaagaaaagcagactgctgtt
gaaaaagctaagaagactgaacctgaaaatgatcacactttaaacgaacttcaagaagaa
aatgaagacactgagacccagaccacacaaatagaaatgatgaaaagatcaccagctttt
atgatcacgtcttcgaatacgttggatgatgctactatcagatatggagaagaacataaa
aaatctcagaagagatgcccattgtattggtgcagatttgctaaaactttcttgacctgg
aattgttgtccctgctggttaaaattgaaagaatttgtccacgtgattataatgcaccca
tttactgatctgtttctcgccatatgcataattctaaacatatattttttgaccttggaa
tgttatccaatgaatgaagaaaccatcagtgctctcagcatcggaaacctggtttttatt
ggaattttcacaggagaaatgatttttaagataattgccatgcacccatatggttatttc
caagcaggttggaacatttttgatagcctaattgtgttccatggtttagcagaacttttt
ctagtgaatgttcatggaatggctctttttcgacccttcagggtgttgcgaattttcaag
ttggggaaatattggccaacgtttaagattctgatgctgactcttagtaactcattggtg
gccctgagaaatttgatcctgctgttgttcacattcatgttcttttctgctgtggtcggc
atgaggctgtttggtttgaattacaaagaatgtgtctgcagcgtagacaaagactgtcaa
ctcccacgttggcacatgatggacttcttccactccttcctgaatgtgttccggattctc
tgtggagagtggatagagactttatgggattgttttaacgtagcaggccaattcagttgt
attcctttttacatgatggtcattttaattggaaacttaatgatattttacctgtttctg
gctttggtgagctcatttagttcatacaattctgcaacaactgaagaaaatgatgaagca
aaaaatctccagcatgcaatagcaaggattaagaaagcagcaaattatgtgctttctaaa
atattatgcaaaaaacaaaatgttcccaaggagaaaatggacaatgtaaatgatacatat
gtcaaagagaatatttctgaccatactctttctgaattgagcaacacccaagatttcctc
aaggataaggaaaaaagcagtggcacagagaaactcacaatgactgaaaatgaaagtcga
tcacttattcccagccctagtgtttctgaaactgtaccaattgcttcaggagagtctgac
atagaaaatctggataataaagagactcacagcaagtcaggctatggaagcagcaaagag
aagataaagccatctagctcatctgaatgcagtacagttgatattgctatctctgaagaa
gaggaaatgatctatgaacatgaaaaacatcctaaaaatggttatggacgaagatcttca
caaggtcaaatcagtagtgaatccaagagaggaaaaatgtggcaaaacataaggaaaacc
tgctgcaagatagttgaaaacagttttttcaagtttttcattggccttgtcactctgctt
agcacaggtgctttggcttttgaagatatatatatcgatcaaagaaagactattaaaatc
ttattagaatatgctgacatgatcttcacttacgtcttcattctggaaatgcttctaaag
tggatggcatatggttttaaagcctatttcactaatggctggtacaggctagacttcatg
gttgttattgtgttttgtcttagtttaatgggcaaatctcgggaagaactaaaacccctt
atttccattaaatttcttcgggccctcagagttctatctcaatttgaaagaatgaaggtg
gttgtaagagctttgataaaaacaactttccccactttgaatgtgtttctggtctgcctt
gtgatctggctggcttttagcattgtgggagtacacttatttgctggcaagttctatgaa
tgcattgacccaacaagtggaggaaggtttcctatatatgaagtcaggaacaagagtcaa
tgtgaaagtcttgtctttaatgaatccatgccatgggagaatgcaaaactaaactttgat
aatgttggaaatggttttctttcactgcttcaagtagcaacatttaatggatggatcact
attatgaattcagctattgattctattggtgtgaatatgcagcctaattttgaagacaac
atctacatgtattattactttattggctttattatctttggattatttcttcctctgact
atgctaactggtgttatgattgctaatttccaaaagcttaaaacaaagggaggctcaaat
atcttcataacagtaaaacagaagaaacaataccgtgcactgaagaagctgatgtatggg
gactctcaaaaaccagtacctcgcccaggaaacaagttccgaggattcatctttgactta
gtaacaaatcaaatttttaatatcatcattatggctcttatctgtttccaagcaatagcc
attatgatacaaagtgatgaacagagtccaaaaatggatgctgctctctactggattaac
tcagtttttgttatgctgtacactggagaatgtcttctgaaactcatctcttttcgttgt
aactacttcaccatcggatggaacatttttgattttatggtagtcattttctccatcaca
ggactacttctgcctttgatggtaggatactaccttgtgcctccttcccttgtgcaactg
atacttctctctcggatcatccacatcctgcgtcccgggaaaggaccaaaggtgtttcat
gatctcctgcttcctttgatgctgtcccttccagcattgttgaacatcagtcttctgatc
ttcctggtcatgtttatctatgccatctttggaatgtacaattttgcctatgttaaaaaa
gaagctggaattaatgatgtgtctaactttgaaacctttggcagcagtatgctctgtctt
ttccaagtgacaatatttgctggttgggatgggatgctcaatgcagttttcaatagtaaa
tggtctgactgtgatcctgataaaattaaccctgggactcaggttagaggagattgtggt
aacccttttgttgggattatttactttgtcagttacatcctcatatcatggttgatcatt
gtaaacatgtacattgttgttgttatggagcttttaaatattgcttctaaaaagaaaatc
aaggctttgagtgaagatgattttaggaaattctttcaggtatggcagaggtttgatcct
gataagacccagtacatagactctagcaagctttcagattttgcagctgctctggatccc
cctcttttcatggcaaaaccgaacaaaggtcagcttgtcgccatggatcttcccatggct
gttggggatagaattcattgctttgacatcttacttgctttttcaaagcgagttatgggt
acagatatgaagatagagaaagttctatcagagatggaatcagggtttattttagccaac
ccgtttaagatcacatatgagccaattacaactactctgaaacgaaaacaagaagcagtc
tcagcaaccatcattcaacgtgcttataaaagttaccgtttgaggcagaatgacaaaaat
acatcagatattcatatgatagatgatgacaggaatggtcaggctacctaagaagatgcc
tactttgataaagctgaagaaaaaactattcaaaactacatctaa

DBGET integrated database retrieval system