KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499593
Entry
107499593         CDS       T06036                                 

Gene name
ITGA9
Definition
(RefSeq) integrin alpha-9
  KO
K06585  integrin alpha 9
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04514  Cell adhesion molecules
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107499593 (ITGA9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107499593 (ITGA9)
   04514 Cell adhesion molecules
    107499593 (ITGA9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107499593 (ITGA9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107499593 (ITGA9)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107499593 (ITGA9)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107499593 (ITGA9)
   05414 Dilated cardiomyopathy
    107499593 (ITGA9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107499593 (ITGA9)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107499593 (ITGA9)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 Integrin_alpha Acetyltransf_14
Other DBs
NCBI-GeneID: 107499593
NCBI-ProteinID: XP_015979404
LinkDB
Position
Unknown
AA seq 1221 aa
MGRARAETRFISRLPLVVGVRGCEREREPRTETQQGGQDSQLRRGFGSPSGPSAQGAAGR
RDGQRLSLARGGARGARGPQGALSRRPAAAAAHPRARLFAVQSRPARDPRAGSSQTSPRG
RGRRPRRAALRSPSAPLGLPPRPDPPPRPPRAHSPPRSLPAVAARRAPRARALGALLAGH
REGGRGDGRRRRARGAGGLRALLLALVAVGTPAGAYNLDPQRPVRFQGPAGSFFGYAVLE
HFHDNTRWVLVGAPKADSKYSTSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGMSCGK
TCREDRDDEWMGVSLARQPKADGRILACAHRWKNIYYETDHILPHGFCYIIPSNLQAKGR
TLIPCYEEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTVKVLNLTDNTYFKL
NDEAIMNRRYTYLGYAVTAGHFSHLSTTDVVGGAPQDEGIGKVYIFRADRRSGTLIKIFQ
ASGKKMGSYFGSSLCAVDLNADGLSDLLVGAPMYSEIRDEGQVTVYINRGNGALEEQLAL
PGDGAYNAHFGESIASLGDLDDDGFPDVAIGAPMEDDFSGAVYIYHGDLSGIVPQYSMKL
SGQKISPVLRMFGQSISGGIDMDGNGYPDVTIGAFMSDSVVLLRARPVITVVSSIFLPAS
INITAPQCHDGQQPVNCLNVTACFSFHGRHVPGEIGLNYVLTADVAKKEKSQLPRVYFVL
HGESVGQVSEKLHLVHMEETCHHYAAHVKRRVQDVISPIVFEAAYSLGEHVTGEEDRELP
ALTPVLRWKKGQKIAQKNQTVFERNCRSEDCAADLQLQGQLLLSSIDEKTPYLALGAVKN
ISLNISISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMR
SKSKYEFSVIFDTSHLSGEEEVLSFIVTAQSGNVERSESLHDNTLTLTVPLMHEVDTSVT
GIMSPTSFVYGESVDASSFIQLDDLECHFQPLNVTLQVYNTGPSTLPGSSVSISFPNRLS
SGGAEMFHVQEMAVGQEKGNCSFQRNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKP
GISCLTMHCNLSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMTRAKVKVDPALRVVEV
ANGNPEEMTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEI
IEAEKNRKENEDSWDWVEKSQ
NT seq 3666 nt   +upstreamnt  +downstreamnt
atgggcagggctagagcagaaactcgattcatctcgcgtcttcctttggtcgtcggtgtg
cgtgggtgtgagagggagcgagagccacgaacagaaacccagcagggcgggcaggactcg
cagctgcggagagggttcgggtcgccttctggcccgagcgcccagggcgcggcggggagg
cgggacggccagaggctctccctggcccggggaggtgcgcggggggctcgcggcccgcag
ggggcgctgtcgcgccgcccggccgccgcggccgcccacccgcgggcgcgcctcttcgca
gtccagagccgcccggctcgggacccgcgcgctgggagctcgcagacttctccgcggggc
cgaggacgccgcccgcgccgggccgccctgcgctcgccttccgcgccgctcggcctgccg
ccccggcccgacccgccgccgcgtccgccccgagcgcacagccccccccggagtctcccg
gccgtcgctgcacgccgcgccccgcgcgcccgcgcgctgggcgccctgctcgccgggcac
agggagggcggccgcggggatgggcgccggcggcgcgcgaggggcgccggggggctccgc
gcgctgctcctcgcgctggtggccgtggggacccccgcgggcgcctacaacctggacccg
cagcgccccgtgcgcttccagggtcccgccggctccttcttcggctacgcggtgctggag
catttccacgacaacacgcgctgggtcctcgtgggtgcaccaaaggcagattccaaatac
agcacttcagtgaagtcccctggtgctgtgttcaagtgccgcgttcacaccaaccctgac
cggagatgcaccgaactggacatggctcgagggaagaatcgggggatgtcctgtggcaag
acctgccgggaagaccgggatgatgagtggatgggggtgagccttgcccggcagcccaag
gctgatggccgaattttggcctgtgcccaccgctggaagaacatctactacgaaacagac
cacatcctgccccacggcttctgttacatcatcccgtccaacctccaggccaaaggcagg
acgctgatcccgtgctatgaagagtacaagaagaagtacggagaggaacacggctcctgc
caggccgggatagcaggcttcttcaccgaggagctggtggtgatgggcgccccggggtca
ttttactgggctgggacggtcaaagtgctgaacctcacggacaacacctacttcaaactg
aatgacgaagccatcatgaacaggcggtacacttacctgggctatgcggttaccgccggc
cacttctctcacctgtccaccaccgatgtggtaggaggcgccccacaggatgaaggcatc
ggaaaggtttatatttttagagctgaccgaagatcaggcaccttaattaagatttttcag
gcatcaggtaaaaagatgggctcttacttcggctcctccttatgcgcagttgacctgaac
gcagatggcctctctgacctgctggtgggggcccccatgtattccgagatcagggacgag
gggcaggtcaccgtctacatcaacagaggaaatggggccctggaggagcagctggccctg
cccggggatggcgcctacaacgcgcacttcggggagagcatcgccagcctgggtgacctt
gacgacgatgggttcccagatgtggccattggcgcacccatggaggacgacttctcaggg
gcggtctacatctaccatggtgacctcagtggaatcgtccctcagtactcaatgaaactg
tcggggcagaagataagtccagttctgcggatgtttggacagtccatatcagggggcatc
gatatggatgggaacggctatcccgatgtgactattggagccttcatgtccgacagtgtg
gtccttctaagggcgagacccgtcattacggtagtgagctccatcttcctcccagcctcc
attaacatcacggcgcctcagtgccacgacggacagcagcctgtgaactgcctgaacgtc
accgcctgctttagcttccacggcaggcatgttcccggagaaattggcctgaattacgtt
ctgacggccgacgtggccaaaaaggaaaagagccagttgcccagggtctactttgtgttg
cacggagagtccgtgggtcaggtctcagagaagctgcatctggtccacatggaggagacg
tgtcatcactatgcggcccacgtgaagcggagggtgcaggacgtcatcagccccatcgtg
tttgaagccgcctacagcctgggcgagcacgtgacgggagaggaggacagggaactgccg
gctctgacgccagtgctccgctggaaaaagggacagaagattgcccagaagaatcagact
gtcttcgaaaggaattgccgttcggaggactgtgccgccgacctgcagctgcagggtcag
ctgctgctgtccagcattgatgagaaaaccccatatcttgctttgggggctgtgaagaat
atctccctgaacatctccatctccaacctcggagacgatgcctatgatgccaacgtgtcc
ttcaacgtttcccgagagctcttctttatcaacatgtggcagaaggaggaaatgggcatt
tcctgtgaactgctggaatcggacttcctcaaatgcagtgtgggatttcctttcatgagg
tcaaagtcaaagtatgaattcagcgtcatctttgatacaagccacctgtcaggggaagag
gaagttcttagcttcatcgttactgctcagagcggcaacgtggagcgctcagaatctctg
cacgacaacaccctcacgctgacggtgccgctgatgcatgaagtggacacgtccgtcact
ggaatcatgtctccaacctcctttgtgtatggcgagtcagtggacgcatctagcttcatt
cagctggatgatctggagtgccatttccagcccctcaacgtcacccttcaggtctataac
actggaccaagcacccttcctgggtcatccgtcagcatctctttccccaatcgactgtca
tctggaggtgcagaaatgttccacgtccaggagatggcggtgggccaagagaaaggaaac
tgttctttccagagaaacccaaccccctgcatcatccctcaagaacaagaaaatatcttc
cataccatatttgcttttttcacgaagtctggaagaaaagtcttggattgtgaaaaacca
ggaatttcttgcctaacaatgcactgtaatctgagtgccctcgctaaagaagaaagtcgt
accatagacatttacatgctgctgaacacagaaatattgaagaaggacagttcctccgtc
attcagttcatgacccgcgccaaggtgaaggtggaccctgccctgagggtggtggaggta
gccaacgggaacccagaagagatgacggtggtcttcgaggccttgcacaacctggagccc
cgtggctatgttgtgggctggatcatcgccatcagtctgctggtgggaatcctcatcttc
ctgctgctggccgtgctgctctggaagatgggcttctttcgccgaagatacaaagaaatt
attgaagccgagaagaaccggaaagagaacgaagacagttgggactgggtcgaaaaaagc
cagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504826
Entry
107504826         CDS       T06036                                 

Gene name
ITGA8
Definition
(RefSeq) integrin alpha-8
  KO
K06584  integrin alpha 8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04514  Cell adhesion molecules
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107504826 (ITGA8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107504826 (ITGA8)
   04514 Cell adhesion molecules
    107504826 (ITGA8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107504826 (ITGA8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107504826 (ITGA8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107504826 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107504826 (ITGA8)
   05414 Dilated cardiomyopathy
    107504826 (ITGA8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107504826 (ITGA8)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107504826 (ITGA8)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 107504826
NCBI-ProteinID: XP_015989862
LinkDB
Position
Unknown
AA seq 1062 aa
MFTGARRGLRGSRGQPLAPFCCLSAALGMLWSPASQAFNLDEDQLTVYSGPEGSYFGYAV
DFHIPAAHTASVLVGAPRANTSQPDIVEGGAVYYCPWPAEGSAQCKQIPFDNTNNRKIRV
NGTKEPIEFKSNQWFGAAVRAHRGKVVACAPLYHWRTLKSTPEKDPVGTCYVAIQNFSAY
AEYSPCRNSNVDPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASIADIIANYS
YKDILRKLAGEKQTDVAPASYDDSYLGYSVAAGEFTGDSQQELVAGVPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYAVAVSDVNSDGMDDILIGAPLFMEREFESNPREIGQVY
LYMQVSALVFEDPQVLAGTEVFGRFGSAVAHLGDLNQDGYNDIAIGAPFAGQDQRGKVLV
YNGNKRGLNTKPSQILQGVWASQAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAVY
RARPVVTVDAQLLLHPVIINLENKTCQIPESTTPVACFSLRACASAAGQSISDTIGLTAE
VELDSLKQKGAIKRTLFLDNHQSRLVFPLATRRQGSRQCRDFTVYLRDETEFRDKLSPIN
IHLNYSLDESTLKQGLEVKPILNHYRENVVTEQAHILVECGEDNLCIPDLKLSARPDKHQ
VIVGDENHLMLMINARNEGEGAYEAELFVIIPEEADYVGIERSIKGFRSLSCEYKMENVT
RTVVCDLGNPMVAGTNYSLGLRFTVPRLEKTHMSINFDLQIRSSNKDNPDSNLVSVQINI
TAVAQVEIRGVSHPPQIVLPIHNWAPEEEPRKEEGVGPLVEHIYELHNIGPSAISDTLLE
VGWPFSARDEFLLYIFHIQTLGPLQCRTNPDINPQDIKPAAPAVDTPELSAFLRNSTIPH
LVRKRDVPVLEPHRQSPVKILNCTNIECLRISCAVGRLEGGESAVLKVRSRLWAKTFLQR
KNDPYSLASLVSFEVKKMPYKDQPEKLPEGSIAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDEMNDREQLTNEKTPGA
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgttcactggggcccgtcgcgggctcaggggcagccgggggcagccgctcgcgcccttc
tgctgcctctcggccgcgctggggatgctgtggtcccccgcctcgcaggcgttcaacttg
gatgaggaccagctcaccgtgtacagcggccccgagggcagctacttcggctacgcggtg
gacttccacatacctgcggctcacacagcgagcgtgttggtgggggcgcccagagccaac
accagccagccggacatcgtggaagggggcgccgtctattactgtccctggcccgccgag
gggtctgcgcagtgcaagcagataccgtttgacaacaccaacaacagaaagatcagagtc
aatggaaccaaggagcccatagagtttaaatccaaccagtggtttggagcagcagtgaga
gctcacagggggaaagtggtggcgtgtgctcccttgtatcattggaggacacttaagtcc
acacctgaaaaggacccagttggcacgtgctatgtagcaattcagaatttcagtgcgtac
gctgagtactctccttgtcggaacagtaacgttgatcctgagggccagggttactgccaa
gcaggatttagtctggatttttataagaacggagaccttatagtcggaggtcctggaagt
ttttattggcaaggtcaggtgattactgccagtatcgcagacatcattgcaaattactca
tacaaggatattctaaggaaactggctggagagaaacagacagacgtggctccagcttcc
tacgacgacagttaccttggatactcggttgctgccggggaatttacaggagattctcag
caagaattggttgccggcgtaccaagaggagcacagaactttggatatgtttcaatcatt
aactctacagatatgacctttattcagaatttcactggtgaacagatggcatcgtatttt
ggatatgcggttgcggtgtcggacgttaacagtgacggaatggatgacatattgattggg
gcacctctctttatggaacgtgaatttgagagtaaccctagagaaatagggcaagtttac
ctgtacatgcaagtgagcgctctcgtcttcgaagaccctcaggtccttgcaggcaccgag
gtgttcgggagattcggcagtgctgtggcacatttaggagacctgaaccaagacggatac
aatgacattgccatcggcgcaccctttgctggccaggatcaaagaggcaaagtgctagtt
tacaacggcaacaaacgtggcttaaacaccaagccttcccagattctgcaaggagtgtgg
gcctcgcaggctgtcccttccggatttggctttactttaagaggcgactcggacatcgac
aagaacgattacccagatttaatcgtgggtgcattcggaacaggaaaagtagctgtttac
agagcaaggccagtggtgacggtggatgcccagctcctgctccacccagtgatcatcaat
ctggaaaataaaacttgccagattccagagtctacaacccctgtggcctgcttttcctta
agagcatgtgcatctgcagcgggccagagcatttcagacacaataggcctgaccgcggag
gtggagttagattctctgaagcagaaaggcgccatcaaacgcacgctcttcctggacaac
catcagtcacgtctcgtcttcccgctggcgacgaggcggcagggctcccgccagtgccgc
gacttcaccgtctacctgcgggacgaaactgaattccgagataaactatcgccaatcaac
attcatctgaattacagtttggacgagtccaccttgaagcaaggcctagaggtgaaacca
atattgaaccactacagggaaaatgtcgtcaccgaacaggctcacatcctggtggagtgc
ggagaagacaatctatgcatccctgacttgaagctgtcagctagaccagataagcatcag
gtcatcgtcggagatgaaaatcaccttatgctcatgatcaatgcaagaaatgaaggagaa
ggcgcctatgaagctgaactcttcgtgataataccggaagaggcagattatgtggggatc
gaacgcagcatcaaggggttccgatcactgagctgtgagtacaagatggaaaatgtaacc
agaacggtagtgtgtgacctcgggaaccctatggtggctggcacaaactattctctggga
ctccggtttacagttccacgtcttgagaaaacacacatgagcatcaacttcgatcttcaa
atcagaagttccaacaaggacaacccagacagcaatcttgtgagcgtgcagatcaacatc
actgctgtagctcaagtggaaataagaggagtctcccaccctccgcagattgtcctgccc
atccacaactgggcaccggaagaggagccccgcaaggaggagggagttggacccttggtg
gaacacatttatgagctgcacaatattggaccgagtgccatcagtgacactcttctggag
gtgggctggccattctctgcccgggatgaatttctcctttatatttttcatattcaaact
ctgggacctctacaatgtcgaacaaatcctgatatcaacccacaggatataaagcctgct
gcccctgcagtggacacccctgagctgagcgcctttctgcgaaactcgaccatccctcac
cttgtcaggaagagagacgtacccgtgctggagccccacagacagagccccgtgaaaatc
ctgaattgtaccaatatcgagtgcctgcggatctcctgcgcggtgggacgactagaagga
ggagaaagtgcagtcctgaaagtcaggtctcggttatgggccaagacattcctccagaga
aaaaatgatccctattctctggcatccctggtgtcctttgaagttaagaagatgccttat
aaagatcagccagaaaaactcccagaaggaagcatagcaattaagacatcagttatttgg
gcaaccccaaatgtttccttctcaatcccattatgggtaataatactagcaatacttctt
ggattattggttctggctattttgaccttagctttatggaagtgcggattctttgacaga
gcgagacccccgcaagatgaaatgaatgacagggagcagctgacgaatgagaagaccccc
ggtgcgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505202
Entry
107505202         CDS       T06036                                 

Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04514  Cell adhesion molecules
ray04640  Hematopoietic cell lineage
ray04810  Regulation of actin cytoskeleton
ray05145  Toxoplasmosis
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05222  Small cell lung cancer
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107505202
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107505202
   04514 Cell adhesion molecules
    107505202
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107505202
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107505202
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107505202
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107505202
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107505202
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107505202
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107505202
   05414 Dilated cardiomyopathy
    107505202
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107505202
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107505202
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107505202
  Exosomal proteins of breast milk
   107505202
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107505202
CD molecules [BR:ray04090]
 Proteins
  107505202
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM Integrin_alpha
Other DBs
NCBI-GeneID: 107505202
NCBI-ProteinID: XP_015990609
LinkDB
Position
Unknown
AA seq 1092 aa
MAAAGQLWLLYLSAGLLPQLGAAFNLDTREDNVIRKTGDSGSLFGFSLAMHRQLQPEDKR
LLLVGAPRAVALPLQRANRTGGLYSCDITSRGPCTRIEFDNDADPSSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIVDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDDITFVSGAPRANHSGAVVLLKRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYINQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDEKGKVFIYHGSANGINTK
PTQVLEGNSRFFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTVTVTPNR
IDLRQKTACGASSGICLKVKACFEYTAKPADYHPLISIVGTLEAEKDRRKSGLSSRVQFR
NQGSEPKYTKELTLNRQKQKACMEETLWLQENIRDKLRPIPITASVELQEPNSRRRVNSL
PEIFPILNSNEPTTVHTDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPISQK
GIPELVLKDQKDIALEITVTNSPSNPRSPTKDGDDAHEAKLIATFPDTLTYSAYRELRAF
PEKQLSCVANQNGSQADCDLGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLETTSNQ
DNLASITATAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKYEDEVGSLIEYEFRVINL
GKPLKNLGTATLNIQWPKEINNGKWLLYLVKVESKGLERIACEPQNEINLLDLKESHNSR
KKREIAEKQIDDNRKFSLFAERKYQTLNCSVNVKCVNIRCPLRGLDSKASVVLRSRLWNS
TFLEEYSKMNYLDILVRASIDVTGATENIKLPNAGTQVRVTVFPSKTVAQHSGVPWWIIL
VAVLAGILMLALLVLLLWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYNDNLEKKQ
WITRWNENESYS
NT seq 3279 nt   +upstreamnt  +downstreamnt
atggcggccgcggggcagctgtggctgctctacctgtccgcagggctcctgccgcagctc
ggcgccgccttcaacttggacacccgcgaggacaatgtgatccgaaaaactggggattcc
gggagcctcttcggcttctcgctggccatgcaccggcagctgcagccggaggacaagcgg
ctgttgctcgtgggggcccctcgggcagtggccctcccactgcagagggccaacagaaca
ggaggcttatacagctgtgacatcacctcccggggcccttgtacacggattgaatttgat
aatgatgcggacccttcatcggaaagcaaggaagatcagtggatgggggtcacggtccag
agccaagggcctgggggcaaggttgtgacatgtgctcatcgctatgaaaaaaggcaacat
gttaatacaaagcaggaatcccgagacatctttggaagatgctatgtcctgagtcagaat
ctcaggattgtagatgacatggatggaggagactggagtttctgtgatggccgattgaga
gggcatgaaaaatttggttcttgccagcaaggtgtagcagccacatttactaaagacttt
cattacattgtatttggagctccaggcacttataactggaaagggattgtccgcgtagaa
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgaccatgatgaaagtctagttcctgttcctgctaacagttatttaggcttt
tctttggactcggggaaagggattgtttctaaagatgacatcacttttgtatctggtgct
cccagagccaatcacagtggagctgtggttttgctgaaaagagacatgaagtctgcacat
cttctccctgaacacatattcgatggggaaggtctggcttcttcctttggctatgatgtg
gcagtggtggaccttaacaaagacgggtggcaagatatagttattggagccccgcagtat
ttcgatagagatggagaagttggaggtgcagtgtatgtctatattaaccagcaaggcaga
tggaataatgtcaagccaattcgtcttaatggaaccaaggattctatgtttggcattgca
gtcaaaaatattggtgatatcaaccaagatggctacccagatattgcagttggagctccc
tatgatgagaaggggaaggtttttatctatcacggatctgcgaacggaataaacaccaaa
ccaacacaggttcttgagggtaattcacgtttctttggatattcaattgccgggaatatg
gaccttgatagaaattcctaccctgacgttgccgttggttccctctcggactcagtaact
attttcagatcccgacctgtgattaacattcagaaaaccgtcacagtgacacctaacaga
attgatctccgccagaaaacggcctgcggggcctctagtgggatatgcctcaaggttaag
gcctgctttgaatatactgccaaacctgctgattatcatcctttaatatccattgtgggc
acacttgaggctgaaaaggatagaagaaaatctgggctgtcatcaagagttcagtttcga
aaccaagggtctgagcccaagtacaccaaagaactaactctgaacaggcagaagcagaag
gcgtgcatggaggagaccctctggctacaggaaaacattagagataaactgcgtcccatt
cccataactgcttcggtagagctccaggagccaaacagtcggaggcgagtgaattcactt
ccagaaatttttccaattctgaattcaaatgaacccacgacagttcatacagacgtgcac
ttcctaaaagagggatgtggagacgacaatgtgtgtaacagcaaccttaaactagaatat
aaattttgtacccgggaaggaaatcaagacaaattttcttatttaccaattagtcaaaaa
ggtattccagaactagttttaaaagatcagaaggacattgctttagaaataacagtgaca
aacagcccttctaacccaaggagtcccacaaaagatggcgatgatgctcatgaagctaaa
ctcattgcaacttttccggatactttgacttattctgcatatagagaactgagggctttc
cctgagaaacagttgagttgcgttgccaaccaaaatggctcacaagcagactgtgatctt
gggaatcctttcaaaagaaattccagtgttacgttttacttgattttaagtacaacagag
gtcacctttgacaccacagatctggatattaatctgaagttggaaacaacaagcaatcag
gataatttggcttcaattactgctacagcaaaagtggttattgaactgcttttatcagtc
tctggagttgctaaaccttcccaggtgtattttggaggcacagttgttggtgagcaagct
atgaaatatgaagatgaagtgggaagtttaatagagtatgagtttagggtaattaacttg
ggcaaacctcttaaaaaccttggcacagcaaccttgaatatccagtggccaaaagaaatt
aacaatggcaagtggttgctttatttggtgaaagtagaatccaaaggattggaaaggata
gcttgtgagccacaaaatgaaatcaaccttctggacttaaaggaatctcacaactcaaga
aagaaacgagaaattgctgaaaaacagatagacgataacagaaaattttctttatttgct
gaaagaaaataccagacccttaactgcagtgtcaacgtgaaatgtgtgaacataaggtgc
ccactgcgtgggctggacagcaaggcctcagttgttctgcgctcaaggttatggaacagc
acatttttagaggaatattctaaaatgaactacttggacattctcgtacgggcttccatt
gatgtaactggtgccacagagaatatcaagctgccaaacgcaggcacacaggttcgtgtg
actgtgtttccctcaaagactgtggctcaacattctggagtaccatggtggatcatcctg
gtggctgtccttgctggaattctgatgcttgctctgttagttcttttattatggaagtgt
ggattctttaaacgctctaggtacgatgatagcgttccccgataccatgctgtcaggatc
cggaaagaagagcgagagatcaaagatgaaaaatataatgataaccttgaaaaaaaacag
tggatcacaaggtggaatgaaaatgaaagttactcttag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508144
Entry
107508144         CDS       T06036                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb isoform X1
  KO
K06476  integrin alpha 2B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04611  Platelet activation
ray04640  Hematopoietic cell lineage
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05222  Small cell lung cancer
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107508144 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    107508144 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107508144 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107508144 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107508144 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107508144 (ITGA2B)
   04611 Platelet activation
    107508144 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508144 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107508144 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107508144 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    107508144 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107508144 (ITGA2B)
   05414 Dilated cardiomyopathy
    107508144 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107508144 (ITGA2B)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107508144 (ITGA2B)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107508144 (ITGA2B)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107508144 (ITGA2B)
CD molecules [BR:ray04090]
 Proteins
  107508144 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 107508144
NCBI-ProteinID: XP_015995237
LinkDB
Position
Unknown
AA seq 1048 aa
MARALCPLHALWLLEWIQLLLGPGAAPPAWALNLDPVRPTFYTGPNGSHFGFSLDFYKDS
RGRKDDPVPCTAHNPFSVGIVVGAPRTVGRSSEETGGVFLCPWRAEGDQCNSLPFNLSDE
NRTVNSQTFQTFKAQQGLGASVVSWRDNIVACAPWQHWNALEKNAEAEKTSVGGCYVAHL
QDGGRAEYSPCRANTMSRVYEANKYWEDRRYCEAGFSSVITQNGELVLGAPGGYFFIGLL
VRAPIADIVSSYRPGTLLWHVRNKRFTFDTGHPEYFDGYRGYSVAVGEFDGNPNTTEYVF
GAPTWRWTLGAVEILRSNYQMMHRLHGEQVASYFGHSVAVTDVNGDGRHDLLVGAPLYME
RRADRKLAEVGRVYLFLQPRGPNALGAPSLLLTGTQLYGRFGSAIAPLGDLNRDGYNDVA
VAAPYGGPSGRGQVLIFLGQSEGLSSRPSQVLDSPFPEGFGFGFSLRGAVDIDDNGYPDL
LVGAYGADKVAVYRAQPVVMATVQLLVQDSLNPAVKNCTHTKTPVSCFNIQMCIGVTGHN
IPQKLLLNAELQLDRQKPRQGRRVLLLSSQQASATLNLDLGGRHSRICHNTTAFLRDEAD
FRDKLSPIVLSVNVSLQPEDGQASALVLHGDTHVQEQTRIILDCGEDDLCVPQLHLTASV
KGSPLLIGADNVLELQMEAANEGEGAYEAELAVYLPPGAHYMRALSNIEGFERLICNQKK
ENETKVVLCELGNPMKRNARIGITMLVSVESLEEAGEHVPFRLQIKSKNSQNPNSEAVLL
NVPVRAEAHVELRGNSFPAFLVVAAEEGDRENNLDDQGPKMEHTYELHNNGPGTVSGLRL
SLHLPGQSQSSDLLYILDIQTQGGLQCSPQPSPDPHKLDWGLPTQTPSPVYLAHPIRKRR
QASLPGPKEPSSLQDPVLVSCDSAPCTVVQCELQEMVRGQRAIVTMLAFLQLPSLRQRPL
DQFVLQSQAWFNVSSLPYAVPAVNLPTGEALVQTQLLRASEERGIPFWWVLVGVLGGLLL
LTLLVLAMWKGGFFKRNRPPLEEDEMEE
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggccagagctttgtgtccacttcatgccctctggcttctggagtggatacagctactc
ttgggacctggtgctgcccctccagcctgggccctgaacctggacccagtgcggcccacc
ttctacacaggtcccaatggcagccactttgggttttcgttggacttctacaaggacagc
cgtgggaggaaagatgatccagtgccctgcacagcacacaacccgttcagcgtgggcatc
gtggtgggtgccccgcggaccgtgggccgcagttcggaggagacaggcggagtgttcctg
tgcccctggagggctgagggcgaccagtgcaattcgctgccgttcaacctcagtgatgag
aacagaaccgtaaactcccaaactttccaaactttcaaggcccagcaaggactgggggcg
tcggtcgtcagctggagagacaacattgtggcctgcgccccctggcagcactggaacgcc
ctagaaaagaacgcagaggctgagaagacatcggtaggtggctgctacgtggctcatctc
caggacggcggccgcgcggagtactcgccctgccgggccaacactatgagtcgggtttac
gaggcaaataaatattgggaagacaggcgctactgcgaagcgggtttcagctcggtgatc
actcagaatggagagctggtgcttggggcccctggcggctattttttcataggtctcctg
gtgcgggctccaattgcagatattgtctcgagttaccgcccgggcaccctcttgtggcac
gtgcgcaacaagcgcttcaccttcgacaccggccacccagagtacttcgacggctaccgg
gggtactcggtggccgtgggcgagttcgacgggaatcccaacactacagagtatgttttc
ggtgctccgacttggaggtggaccctgggagcggtggaaattttgcgctcgaactaccag
atgatgcaccggctgcatggagagcaggtggcttcctatttcgggcactcggtggccgtc
actgacgtcaacggggacgggaggcacgacctgctggtgggcgctccactgtacatggaa
cgccgcgccgaccgcaaactggccgaggtggggcgcgtatacttattcctgcagccgcgg
ggccccaacgcgctgggcgcccccagccttctgctgaccggtacacagctctatgggaga
tttggctcagccatcgcgcctctgggcgatctcaaccgggatggctacaacgatgttgca
gtggctgccccttacgggggtcccagtggtcggggccaagtgctgatattcctaggtcaa
agcgagggacttagctcacgcccgtcccaggtcctggacagccccttccccgaaggcttt
ggctttggcttctccctgcgaggtgctgtagacatcgatgacaatggatacccagacctg
ctggtgggagcttatggggctgacaaggtggctgtgtacagagctcagccggtggtgatg
gccactgtccagctgctggtgcaagattcactgaatcccgctgtgaagaactgtacccac
accaagacaccagtgagctgctttaacatccagatgtgtatcggagttactgggcacaac
attccccagaagctgctcctgaatgccgagctgcagctggaccggcagaagccccggcag
ggccggcgggtgctactgctgagttctcagcaggcgagcgccaccctgaacctggacttg
ggcgggaggcacagccgcatctgccacaacaccactgccttcctccgggatgaagctgac
ttccgggacaagctgagccccatagtgctcagcgtcaatgtgtccctgcagcctgaggat
gggcaggcctctgctctcgtgctacatggagacacccacgtccaggagcagacccgcatc
atcttggactgtggggaagatgacctgtgtgtaccccagcttcatctcactgccagcgtg
aaaggctccccacttctaattggagctgataatgtgctagagctgcagatggaggcagcc
aacgagggggagggagcctatgaggccgagctggctgtgtacctgcccccaggggcccac
tacatgcgagccctcagcaacatcgagggctttgagaggctcatctgtaaccagaagaag
gagaatgagaccaaggttgtgctgtgtgagctgggcaaccccatgaagaggaacgcccgg
ataggaatcacgatgttggtgagtgtggagagcctggaggaggctggggagcacgtgccc
ttccggctgcagatcaagagcaagaacagccagaatccgaacagtgaggccgtgctgctg
aatgtgccagtccgggcagaggcccatgtggagctgcgtgggaactcttttccagctttt
ctggtggtggcggcagaagaaggtgacagggagaacaacttggatgaccagggccccaaa
atggaacacacctatgagctccacaacaatggccctgggactgtaagtggcctccgcctc
agcctccacctccccggccagtctcagtcctctgacctgctctacatcctggatatacag
actcaaggggggcttcagtgctccccacagccctctcccgacccccacaagctggactgg
gggctgcccacccagaccccttcccccgtctacctagcccatcccatccggaagcgcagg
caggcatccctgccagggcccaaggaaccctccagtcttcaggatccagttcttgtgagc
tgcgactcggcgccctgtactgtggtgcagtgtgagctgcaggagatggtgcgcgggcag
cgggccatagtcaccatgctggccttcctgcagctgcccagcctccgccagaggccactg
gatcagtttgtgctgcagtcgcaggcttggttcaatgtctcctccctcccctatgctgtg
cctgccgtcaacctgcccacgggggaagctctggtgcagacacagctgcttcgggcctcg
gaggagaggggcattccgttctggtgggtgctggtaggcgtgctgggtggcctgctgttg
ctcacacttctggtcctggccatgtggaagggcggcttcttcaagcgaaatcggccaccc
ctggaagaggatgagatggaggagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508924
Entry
107508924         CDS       T06036                                 

Gene name
ITGA11
Definition
(RefSeq) integrin alpha-11
  KO
K06587  integrin alpha 11
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107508924 (ITGA11)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107508924 (ITGA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107508924 (ITGA11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107508924 (ITGA11)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107508924 (ITGA11)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107508924 (ITGA11)
   05414 Dilated cardiomyopathy
    107508924 (ITGA11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107508924 (ITGA11)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107508924 (ITGA11)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Ku_N
Other DBs
NCBI-GeneID: 107508924
NCBI-ProteinID: XP_015996456
LinkDB
Position
Unknown
AA seq 1188 aa
MDLHRGLLMAWALSLWPGFTDTFNMDTRRPQVIPGSREAFFGYTVQQHDIDGKKWLVVGA
PLETNGHQKTGDVYKCPVTHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLA
CSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVE
VQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVTDVVEAASHIEQRGGTET
RTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVL
GYYNRRGINPEAFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNET
SFGLEMSQTGFSSHVVEDGILLGAVGAYDWNGAVLKETTGGKVIPLRESYLKEFPEELKN
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQSLRGEQIGSYY
GSEITSVDIDGDGVTDVLLVGAPMYFSEGRERGRVYVYNLRQNRFISNGTLKDSHSYQNA
RFGSSIAAVQDLNQDSYNDVVVGAPLEDNHKGAIYVFHGFQGSLLKTPKQRIAASELAPG
LQYFGCSIHGELDLNEDGLVDLAVGGLGNAVILWSRPVVQVNASLHFEPPKINIFHRDCK
RSGRDATCLAAFLCFTPIFLAPNFEAATVGIRYNATMDEKRYTPRAHLDDSGDRYTNRAV
LLSSGQEHCDRINFHVLDTADYVKPVTFSVEYSLEDPDYGPMLDDGWPTTLRVSVPFWNG
CNEDEDCVPDLLLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRRRVAV
EAMLENRGENAYSTVLNISQSANLQFASLIQKDDSDGSIECVNEEKRLHKKVCNVSYPFF
RAKAKVAFRLDFEFSKSIFMHHLEIQLAAGSDSDEEESTKEDNTVLLRFHLKYEADILFT
RSSSLSHYEIKPNSSLERYDGIGPPFNCIFKIQNLGLFPVHGVMMKITVPIATRGGNRLL
MLRDFLTDQVNTSCNVWGNSTEYRHAPMEEDLSRAPQLNHSNSDIVSINCNVRLAPNQEI
NFHLLGNLWLRSLKALKYKSMKITVNAALQRQFHSPFIFREEDPSRQVTFEISKQEDWQI
PIWIIVGSTLGGLLLLALLVLALWKLGFFKSAKRRREPGLDPNPKTLE
NT seq 3567 nt   +upstreamnt  +downstreamnt
atggacctgcacaggggactcctgatggcctgggcgctcagcctatggccagggttcaca
gacaccttcaacatggacaccaggaggccccaggtcatccctggctccagggaagccttc
tttggctacacggtgcagcagcatgacatcgatggcaagaagtggctggttgtgggcgct
ccattggaaaccaacggccaccagaagacaggagacgtgtacaagtgtccggtgacccat
gggaactgcaccaaactcaacctgggaagagtcaccctatccaacgtatctgagcggaag
gacaacatgcgcctcggcctgagcctggccacaaaccccaaggacaacagcttcttggcc
tgcagccccctctggtctcatgagtgtgggagctcctactacaccacaggaatgtgttca
agagtcaactccaacttcagattctccaagaccgtggccccagctctacaaaggtgccag
acctacatggacatcgtcattgtcctggatggctccaacagcatctacccctgggtagag
gttcagcacttcctcatcaacatcttgaagaagttttacattggccctgggcagatccag
gttggagtcgttcagtacggagaggacgtggtgcatgaatttcacctcaatgactacagg
tctgtaacggacgtggtggaagccgccagccacattgagcagagaggaggaacagagaca
cggacggcatttggcatcgaatttgctcgctcagaggctttccagaagggcggaaggaaa
ggggccaagaaggtgatgattgtcatcacggatggggagtcccacgacagcccggacctg
gagaaggtgatccagcaaagcgagagagacaacgtgaccagatacgccgtggctgtcctg
ggctactacaaccgcagagggatcaatccagaagcttttctaaatgagatcaaatacatc
gccagtgatcccgatgataagcacttcttcaacgtaaccgatgaggcggccctgaaggac
attgttgatgcccttggggacaggatcttcagcttggaaggcaccaacaagaatgaaacc
tcctttggtctggagatgtcacagacgggcttctcctctcacgtggtggaggacgggatt
ctgctgggtgccgtgggtgcctacgactggaatggagctgtgctgaaggagaccactggc
gggaaggtcattcctctgcgagagtcctacctgaaggaattccccgaggagctcaagaac
cacggcgcatacctggggtacacagtcacatcggtcgtgtcctccaggcagggacgggtg
tacgtggctggagccccccgtttcaaccacacaggcaaagtcattctgttcaccatgcac
aacaaccggagcctcaccatccaccagtccctgcggggcgagcagataggctcttactac
gggagtgagatcacttcggtggacatcgacggcgacggtgtgactgacgtcctgctggtg
ggcgcgcccatgtacttcagtgagggccgagagcggggcagggtgtacgtctacaacctg
agacagaatcggttcatttctaatggaacactgaaggattctcacagttaccagaatgcc
cgattcgggtcctccatcgccgcagtacaggacctcaatcaagattcctacaacgacgtg
gtggtgggagcccctttggaggacaaccacaaaggtgccatctatgtcttccacggcttc
caaggcagcctcctcaagactcccaagcagagaattgctgcttcggagctggctcccggc
ctccagtatttcggctgcagcatccatggggaactggacctcaacgaggatgggcttgtc
gacctggcagtgggcggcctcggcaacgccgtgattttgtggtcccgccctgtggttcag
gtcaatgccagcctccacttcgagccacccaagatcaacatcttccacagagattgcaaa
cgcagcggcagagacgccacctgcctggccgccttcctctgcttcacacccatcttcctg
gcacccaatttcgaagcagcaacagttggcatcaggtataatgccaccatggacgagaag
cggtacacaccacgggcccacctggatgacagtggagaccgatacaccaacagggccgtc
ctactctcctctggccaggaacactgtgaccggatcaacttccatgtcctggacaccgct
gactatgtgaagccagtgaccttctcagttgagtattccctggaggaccccgactatggc
cccatgctggacgacggctggcccactaccctcagagtctcggtgcccttctggaatggc
tgcaatgaggatgaggactgtgtccctgacctcctgctggatgcccgcagtgacctgccc
acagccatggagtactgccagagggtgctgaggaagcctgctcaggactgttctgcatac
acactgtcctttgacacaacggttttcatcatagagagcacacgccggcgggtggcagtg
gaggccatgctggagaacaggggcgagaacgcctatagcacagtcctaaatatttcacaa
tcagcaaacctgcaatttgccagcttgattcagaaggatgactccgatggcagcattgag
tgtgtgaacgaagagaagagactccacaagaaagtctgcaacgtcagctaccccttcttc
cgggccaaagccaaggtggctttccgtctagatttcgagttcagcaaatccatcttcatg
caccacctggagatccagctcgcagccggcagtgacagtgacgaggaggagagcaccaag
gaagacaacacggtcctcctgcgcttccacctcaagtatgaggccgacatcctcttcacc
aggagcagcagcctgagccactatgagatcaagcccaatagctcactggagagatatgat
ggcatagggcctcccttcaactgcattttcaagattcaaaacttgggcttgttccctgtc
cacggggtgatgatgaagatcaccgtgcccatcgccaccaggggcggcaaccgcctgctg
atgctgagggacttcctcaccgaccaggtgaacacgtcctgtaacgtgtggggaaacagc
accgagtaccggcatgccccgatggaggaagacttaagtcgtgccccacagctgaatcac
agcaactctgacatagtctccatcaactgcaacgtgaggctggcccccaaccaggaaatc
aatttccatctgctggggaacctgtggttgcggtccctaaaagcactcaagtacaagtcg
atgaaaatcacggtcaatgcagccttgcagagacagtttcacagtcctttcatctttcga
gaggaggatcccagccgccaggtcacgtttgagatctccaagcaagaagactggcagatc
cccatctggatcattgtgggcagcacactggggggcctcctactgctggccctgctggtc
ctggcgctgtggaagctcggcttctttaaaagtgccaagcgtagaagagagccaggcctg
gaccccaacccgaaaacactggagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509660
Entry
107509660         CDS       T06036                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04611  Platelet activation
ray04640  Hematopoietic cell lineage
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05222  Small cell lung cancer
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107509660 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107509660 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107509660 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107509660 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107509660 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107509660 (ITGA2)
   04611 Platelet activation
    107509660 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509660 (ITGA2)
   05205 Proteoglycans in cancer
    107509660 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107509660 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107509660 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107509660 (ITGA2)
   05414 Dilated cardiomyopathy
    107509660 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107509660 (ITGA2)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107509660 (ITGA2)
  Exosomal proteins of bladder cancer cells
   107509660 (ITGA2)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107509660 (ITGA2)
CD molecules [BR:ray04090]
 Proteins
  107509660 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 107509660
NCBI-ProteinID: XP_015997853
LinkDB
Position
Unknown
AA seq 1178 aa
MRPGQRGGAPLRLVLVLSQGILNCCMAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNW
LLVGSPWSGFPENRMGDVYKCPVDLATATCEKLNLQTSTSIPNVTEMKTNMSLGLTLTRN
MGTKGFLTCGPLWAQQCGSQYYTTGVCSDVNADFQLLASFSPAVQTCPSLIDVVVVCDES
NSIYPWEAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTFKSKAEMVAAASQT
FQHGGDLTNTFKAIQYARHFAYAASAGGRPGATKVMVVVTDGESHDGSMLKAVIDQCNKD
NILRFGIAVLGYLNRNSLDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTIGEQIF
SIEGTVQGGDKFQMEMSQVGFSADYSPQNDILTLGAVGAYDWSGTIVQQTSHGHSIFPKQ
AFDQTLQDRNHSSYLGYSVAALSTGKSVYFVAGAPRANYTGQIVLYSVNENGNVTVIQTH
RGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNNLKKEEGRVYLFTITKGILNWHQF
LEGPEGIENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHENTIRTKYSQ
KILGSDGAFKSHLQYFGRSLDGFEDLNGDSITDVSIGAFGQVVQLWSQSIADVSVDASFT
PEKITLFNKNAEINLKLCFSAKFRPAKQNSQVAITYNITIDADLYSSRVTSRGLFKENNE
RFLQKNMIVHQAQSCSEFIILIQEPSDVVNSLDLCVNISLENPGTSPALEAYSESAKVFS
IPFYKDCGDDGVCISDLVLDVQQLPAAQDQPFIVSNQNKILTFSVTLKNKKESAYNTGIV
VDFSENLFFASWSMPVDGTEVTCQVTSQKSVTCDVGYPALKRKQQVTFTINFDFNLQNLQ
NQASVSFQALSESYEENKADNSVSLKIPLLYDAEIHITRSTNIRFYEVSSDGNVPSIVHN
FEDIGPKFIFSIKVTTGSIPVSMASVVIRIPQHTKEKNPLMYLTGVHTDQAGDISCNAEI
NPLKIGQTSSSVSFKSENFRHVKDLNCRTASCSNVTCWLKDPQVKGEYFLNVSTRIWNGT
FAASTFQSVQLTASAEVNTYNPQIYVIEENTVTIPITIMKPHEKAEVPTGVIVGSVIAGI
LLLLALVAILWKLGFFKRKYEKMTKNPDDMDETTELNS
NT seq 3537 nt   +upstreamnt  +downstreamnt
atgcggccaggacagagagggggcgcgccgctgcggctggtgttagtgctcagtcaaggc
attttaaattgttgtatggcatacaatgttggtcttccagaagcaaagatattttccggt
ccttcaagtgaacagtttggctatgcagtacagcagtttataaatccaaaaggcaactgg
ttactggttggttcaccttggagtggctttcctgagaaccgaatgggagatgtgtataaa
tgtcctgttgatctagccactgctacatgtgaaaaactcaatttgcaaacttccacgagc
attcccaatgttacagagatgaaaaccaacatgagccttggcttgacactcacaaggaac
atggggaccaaaggatttctcacatgcggtcccctctgggcgcagcagtgtggaagtcaa
tattatacaactggtgtttgttctgacgtcaacgctgattttcaactcttggctagcttt
tcaccagcagtgcagacctgcccttccctcattgatgtcgtggttgtatgtgatgaatca
aacagtatctatccctgggaggcagtaaaaaattttttggaaaaatttgtacaaggcctg
gacataggccccacaaagacacaggtagggttaattcagtatgccaataatccaagagtt
gtgttcaacctgaacactttcaaaagcaaagctgaaatggttgcagcagcatctcagaca
tttcaacacggtggggacctcacgaatacgttcaaagcaattcaatatgcaagacatttc
gcttatgcagcatctgctggtggacgaccaggtgctaccaaagtaatggtggttgtaact
gatggtgaatcacatgatggttcaatgttgaaagctgtgattgatcagtgtaacaaggac
aatatactgaggtttggcatagcagttcttgggtacttaaacagaaattcccttgatact
aaaaatttaataaaagaaattaaagcaattgccagcattccaacagaaagatactttttc
aatgtgtctgatgaagcagctctattagaaaaggccgggacaataggagaacaaattttc
agcattgaaggtactgttcaaggaggagataaattccagatggaaatgtcacaagtggga
ttcagcgcagattactctcctcaaaatgatattctgacgcttggtgcagtaggagcttat
gactggagtgggacaattgttcagcagacatctcatggacattcgatctttcctaaacaa
gccttcgaccaaactctgcaagatagaaatcacagttcgtatttaggttactctgtggct
gcactttctactggaaaaagtgtctactttgttgctggtgctcctcgggcaaattatact
ggccagatagtgctgtacagtgtaaacgagaatggcaatgtcacagttatccagactcac
agaggtgaccagattggctcctattttggtagtgtgctgtgttcagttgatgtggataaa
gacaccattacggatgtgctcttggtgggtgcgccaatgtacatgaacaacctgaagaaa
gaggaaggaagagtctacctgtttactatcacaaagggcattttgaattggcaccaattt
cttgaaggccccgagggtattgaaaatgctcggtttggttcagcaattgcagctctctca
gacatcaacatggacggctttaacgatgtgatagttggctcacctttggaaaatcagaac
tctggcgctgtgtacatctacaatggtcatgagaacaccattcgcacaaagtattcccag
aaaatcttgggatctgatggagcctttaagagccatctccagtactttggcagatccttg
gatggctttgaagatttaaatggggattccatcaccgacgtgtccatcggtgcctttgga
caagttgttcagctctggtcacagagtattgctgatgtatctgtagatgcttcattcaca
cctgaaaaaatcactttgttcaacaagaatgctgagataaacctcaaactctgcttcagt
gcaaagtttagacctgctaagcaaaacagtcaagtggccattacatataacatcacaatt
gatgcagacctgtattcatccagagtaacctccaggggtttatttaaagaaaataatgaa
aggttcttgcagaagaatatgatagtacatcaagcacagagttgctccgagttcatcatc
ctcatacaggagccctctgatgttgtcaactccttggatctgtgtgtgaacatcagcctg
gaaaaccctggcactagccccgcccttgaagcctactctgagtccgccaaggtcttcagt
atccctttctataaagactgtggtgacgatggagtttgcatatctgacctagtcctagat
gtccaacagctgccagctgctcaagaccaaccctttattgttagcaaccaaaacaaaata
ttaacattttcagtaacactgaagaacaaaaaggaaagtgcatacaacactgggatcgtt
gtcgatttttcggaaaacttgttttttgcttcctggtccatgccggttgatgggacagaa
gtaacatgccaggttacttctcagaagtctgttacctgtgatgtaggctaccctgcttta
aagaggaaacaacaggtgacgtttactattaacttcgacttcaatcttcaaaaccttcaa
aatcaggcatctgtcagtttccaagccttaagtgaaagctacgaagaaaacaaggcagat
aattccgtcagcctcaaaattcctctgctgtatgatgccgaaattcacataacaagatct
accaacataaggttttatgaagtttcctcggatgggaatgttccttctatcgtgcacaat
tttgaagatattggtccaaaattcatcttctccattaaggtgacaacaggaagtattcca
gtaagtatggcatccgtcgtcattcgcatccctcagcacaccaaagaaaagaacccactg
atgtacctgactggagtacacacggatcaggccggtgacattagttgtaatgctgaaata
aatccactgaaaataggacaaacgtcttcttctgtatctttcaagagtgaaaatttccgg
cacgtgaaagatttgaactgcagaacggcttcgtgcagtaatgttacctgctggctgaaa
gaccctcaggtgaaaggagagtacttcctcaatgtgtccaccagaatctggaacgggact
ttcgcagcatcaactttccaaagcgtacagctgacggcctctgcagaagtcaacacctac
aaccctcagatatatgtgatcgaagaaaacaccgtcacgattcccattacgataatgaaa
ccccatgagaaagccgaagtaccaaccggagttatagtaggaagtgtaattgctggaatc
cttttgctattagctctggttgcaattttatggaagcttggcttcttcaaaagaaaatat
gaaaaaatgaccaaaaatccagatgacatggacgagaccacagaactcaacagctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509664
Entry
107509664         CDS       T06036                                 

Gene name
ITGA1
Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-1
  KO
K06480  integrin alpha 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04640  Hematopoietic cell lineage
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107509664 (ITGA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107509664 (ITGA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107509664 (ITGA1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107509664 (ITGA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107509664 (ITGA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107509664 (ITGA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107509664 (ITGA1)
   05414 Dilated cardiomyopathy
    107509664 (ITGA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107509664 (ITGA1)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107509664 (ITGA1)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107509664 (ITGA1)
CD molecules [BR:ray04090]
 Proteins
  107509664 (ITGA1)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 HisK_sensor LYRIC Integrin_alpha Cation_ATPase_N
Other DBs
NCBI-GeneID: 107509664
NCBI-ProteinID: XP_015997862
LinkDB
Position
Unknown
AA seq 1178 aa
MAPPCPANPGVAVACCWLLTVVLGFCASFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKNRTGDVYKCPVGRGESLPCIKLDLPVNTSISNVTEVKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPAFQVVNSIAPVQECSTQLDIVIVLDGS
NSIYPWESVTAFLNNLLERMDIGPKQTQVGIVQYGENVTHEFNLNTYSSTEEVLVAANKI
GQRGGRQTMTALGIDTARKEAFTEARGARRGIKKVMVIVTDGESHDNHRLNKVIQDCEDE
NIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVEALGERIF
ALEATADQSAASFEMEMSQTGFSAHYSRDWVMLGAVGAYDWNGTVVMQKANQIIIPRNTT
FNVKSTKKNEPLASYLGYTVNSATIPGDVLYIAGQPRYNHTGQVVIYRMEGGDIRILQTL
RGEQIGSYFGGVLTTVDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQMS
LEPIKQTCCSSLKHNSCTKENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHGG
AVYIYHGSGKTVRKEYAQRIPSGGDGETLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAAL
FWSRDVAVVKVTMNFEPNKVNIQKKNCRMEGKETVCINATVCFDVKLKSKEDTVYEADMR
SVTLDSLRQISRSFFSGTQERKIQRNITVRESECTKHFFYMLDKHDFRDSVRITLDFNLS
NPENGPVLDDSLPNSVHEHIPFAKDCGNKEKCISDLTLDVSTTEKGLLIVRSHNDKFNVS
ITVKNKKDSAYNTRTIVHYSPNLIFSGIEAIQKDSCESNHNITCKVGYPFLKRGEMVTFK
ILFQFNTSYLMENVTIHLSATSDSDEPLETLYDNEVNISIPVKYEVGLQFYSSASEHHIS
IAANETVPEVINSTEDIGNEINIFYLIRKSGHFPMPELKLSISFPNLTSDGYPVLYPNGW
SSSDNANCRPSSLQDPIGINSKKKTIIFKSEDFKRGTILDCSSCKFATITCNLIPSDMSQ
VNVSLTLWKPTFIKAHFSSFNLTVKAELQSENASLVLSTGNQKRQLAIQISKDGLPGRVP
LWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3537 nt   +upstreamnt  +downstreamnt
atggcccctccgtgccctgccaacccaggggtcgctgtcgcctgctgctggctcctcacc
gttgttctaggcttctgcgcatccttcaatgttgatgtgaaaaattcaatgactttcagc
ggccctgtggaggacatgtttgggtatactgttcagcaatatgaaaatgaagaaggaaaa
tgggtgcttattggttctcctttagttggccaacccaagaacagaactggagatgtctat
aagtgtccagttgggagaggagaatcgttaccttgcataaagttggacctaccagttaat
acatcaatttccaatgtcacagaagtaaaggagaacatgacgtttggatcaacattagtt
accaacccaaacggagggtttctggcatgtgggcccttatatgcctatcgatgtggacat
ttgcattacacaactggaatctgttctgatgtcagccccgcatttcaagtcgtgaactcc
attgcccctgtacaagaatgcagcactcaactggacatagtcatcgtgctggatggttcc
aacagcatctacccctgggagagtgttacagcttttctaaataaccttcttgaaagaatg
gatattggtcctaagcagacacaggttggaattgtacagtatggagaaaatgtaacccat
gagttcaacctcaatacctactcatcgacagaagaggtactcgttgcggcaaataaaata
ggccagagaggtggccgccagactatgacagcccttggaatagacacagcaaggaaagag
gctttcactgaagctcggggcgcccgaagggggattaaaaaagtcatggtcattgtgact
gatggagagtcacacgacaaccatcgactgaataaggtcatccaggactgcgaggatgaa
aacattcagcggttttccatagctattcttggcagctataatagaggaaatttaagcact
gaaaaatttgtggaggaaataaaatcaattgcaagtgagcccactgaaaagcatttcttc
aacgtctcagatgaattggctctagtcactattgttgaagctctgggagaaagaatattt
gccctggaagctacagctgaccagtcagcagcttcatttgaaatggaaatgtctcagacc
ggcttcagtgctcattattcgcgggactgggtcatgcttggagcagtaggagcctatgat
tggaatggaacggtcgtcatgcagaaggctaatcaaatcataatcccccgaaacacgacc
tttaacgttaagtctaccaaaaagaatgaaccgcttgcttcttatttaggttacacagta
aactccgccaccatccctggagatgtgctttacattgcgggccagccccggtacaaccac
acaggccaggttgtcatctataggatggaaggtggagacatcagaattctccagacactc
cgtggagaacagatcggttcctactttggtggtgttttaacaacagttgacattgataaa
gattctaatactgacattcttctggtcggggctcccatgtacatggggacagagaaggag
gagcaaggaaaagtgtatgtgtacgcactgaatcagacaaggtttgaatatcaaatgagc
ctggaacccattaagcagacttgctgttcatctctgaagcacaattcatgcacaaaagaa
aacaaaaatgagccgtgcggggctcgttttggaacagctattgctgccgtgaaagacctc
aatcttgacggatttaatgacatcgtgataggggctcccctggaagatgatcacggggga
gccgtgtacatttatcatggaagtggcaagactgtaagaaaagagtatgcacaacgtatt
ccatcaggtggagatggcgagacactgaaattttttggccagtctattcacggagaaatg
gatttaaacggtgacgggctgactgatgtgactatcgggggccttggtggtgctgccctc
ttctggtcccgagacgtggctgtagttaaagtgaccatgaattttgaacctaataaagta
aatattcaaaagaaaaactgccgcatggagggaaaggaaacagtttgcatcaatgctaca
gtgtgttttgatgtgaaattaaaatccaaagaagacacggtttatgaagccgatatgcgc
agtgtcacactagattcactaagacaaatatcacgaagttttttctctggaactcaagag
agaaagattcaaagaaacatcacagttcgagaatcagaatgcactaagcatttcttctac
atgttggacaagcatgacttccgggactctgtaagaataactttggattttaatcttagc
aatccagaaaatgggcctgttcttgatgattctctaccgaattcagtacatgaacatatt
ccctttgccaaagattgtggaaacaaggaaaaatgcatctcagacctcaccctggatgta
tccactacagaaaaaggcctgcttatcgtcaggtcccacaatgataagttcaacgttagc
atcacagtcaaaaataaaaaggacagtgcctataacaccagaaccatagtgcattattct
ccaaatctaattttttcaggaattgaggctatccaaaaagacagttgtgaatccaatcat
aatatcacatgtaaagttggatatcctttcctgaaaagaggagaaatggtaactttcaaa
atattatttcagtttaatacatcctatctcatggagaatgtgaccattcatttaagtgca
acaagtgacagtgatgaacctctcgaaactctttatgataatgaagtaaacatctctatc
ccagtaaaatatgaagttggactacagttttacagctctgcaagtgaacaccatatttca
attgcggccaatgagacagttcctgaagttattaattctactgaggacattggaaatgaa
ataaatatcttctacttgattagaaaaagtggacattttccaatgccagaacttaagctg
tcaatttcgtttcccaacttgacatcagatggttatcctgtgctgtacccaaatggatgg
tcatcttctgataatgcaaactgcagacccagtagcctccaggatcctattggtatcaac
tctaagaagaaaacgattatattcaaatctgaagatttcaaacgaggcacaattctggac
tgcagctcatgtaaatttgctaccatcacatgtaatctgattccgtctgacatgagccaa
gtgaatgtttcacttaccttatggaaaccaacttttataaaagcacatttttccagcttt
aatcttactgtgaaggcagaacttcagagtgaaaatgcatctctggttttaagtacaggc
aatcaaaaaaggcagcttgctattcaaatatccaaagatgggctaccaggcagagtacca
ttatgggttatcttgttaagtgcttttgccggattattgcttttaatgctgctcatatta
gcactgtggaagattggattcttcaaaagaccactaaagaagaaaatggagaaatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510088
Entry
107510088         CDS       T06036                                 

Gene name
ITGA10
Definition
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-10
  KO
K06586  integrin alpha 10
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107510088 (ITGA10)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107510088 (ITGA10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107510088 (ITGA10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107510088 (ITGA10)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107510088 (ITGA10)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107510088 (ITGA10)
   05414 Dilated cardiomyopathy
    107510088 (ITGA10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107510088 (ITGA10)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107510088 (ITGA10)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VCBS VWA_2 FG-GAP_2
Other DBs
NCBI-GeneID: 107510088
NCBI-ProteinID: XP_015998788
LinkDB
Position
Unknown
AA seq 1177 aa
MERPLIPHLCWPLMFLTGLCSPFNLDVHHPRLFPGPPEAEFGYSVLQHVGGGRRWMLVGA
PWDGPSGDRRGDVYRCPVGGSHNAPCAKGHLGDYPLGNSSRPAVNMHLGMSLLETDGDGG
FMACAPLWSRACGSSVFSSGICARVDASFRPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGRLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVRNVRECNAGKEG
YSFSSLRRSCFTRTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY
GIAVLGHYIRRQRDPSSFLREIRAIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
RGENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEEEGHRLFPPRTALEDE
FPPALQNHAAYLGYSVSSMFLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGWGCARSRQSL
QGEQIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGLCVRVYFRLLSPPRRQQ
PLLTFQGTLQPEPAQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHRGALYLYHGTQNG
VRPRPAQRIAAVSMPQALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAVLLSSQPIVHLAP
SLDVSPPAISVVQRDCRRRGQEAACLSAALCFQVTSRTRGRWDRRFHLRFTASLDEWTAG
ARAAFDGSGQRLSPRRLRLTVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTKPGPV
LDEGSPTSIRKLVPFSKDCGPDNECVTDLVLLANMDIRGSREDPFLVRGGRRKVLVSATL
ENRMENAYNTSLRLSFSRNLHLASFTPQRDRPVKVECAAPAPHARLCGVGHPVFPTGAKV
TFLLEFEFSCSSLLSQVLVRLTATSSSREGSGTLRDNTAEASAYVQYEPHLLFSSESTLH
RYEVHPYGTLPVGPGPEFKTTLRVQNLGCYVVSGLIISAFLPAVAHGGNYFLSLSQVITN
NASCIVQNLTEPPGPPVHPEDLQHSSRLNGSNTRCQVVRCHLGWLAKGAEVSVGLLRLVH
NEFFRKAKFKSVTVVSTFELGAEEGSVLQLTEASRWSESLLEVIQTRPILISLWILIGSV
LGGLLLLALLVFCLWKLGFFARKKIPEEEKREEKLEQ
NT seq 3534 nt   +upstreamnt  +downstreamnt
atggagcgccccctcatccctcacctgtgctggcccctgatgttcctgacaggtctctgc
tccccctttaacctggatgtgcatcacccacgcctcttcccaggaccacccgaggctgaa
tttggatacagtgtcttacaacatgttgggggcggacggcgatggatgctggtgggtgcc
ccctgggacgggccgtcaggtgacagaaggggagatgtttaccgctgccctgtagggggc
tcccacaatgccccatgtgctaagggccacttgggtgactatccattgggaaattcatct
cgtcctgctgtgaacatgcacttggggatgtctctactagagacagatggtgatggggga
ttcatggcctgtgcccctctctggtctcgtgcctgtggctcctcggtcttcagttctggg
atctgtgcccgcgtggatgcttcattccgcccgcagggaagcctggcacccacggcacaa
cgctgccccacatacatggacgtggtcattgtcttggatggctccaacagcatctacccc
tggtccgaagttcagactttcctacgaagactggtagggagactgtttattgacccggag
cagatacaggtggggctggtacagtatggcgagagccccgtacacgagtggtccttggga
gatttccgaaccaaggaagaagtgcgcaatgttcgggaatgcaatgccgggaaggagggg
tattccttctcctctctgaggcgctcctgctttacgcgcacagaaggcttcagccagtcc
catgggggccgcccggaggctgccaggcttctggtggttgtcactgacggagaatcgcac
gacggagaggagcttcccgcggcactaaaggcctgtgaggctgggagagtgacacgctat
gggattgcggtcctcggtcactacatccggcggcagcgagaccccagctcgttcctgcgg
gagatcagagctatcgccagtgatccagacgagagatttttcttcaatgtcacggatgaa
gctgcgctgacggacatcgtggatgctctaggagaccggatttttggcctcgaggggtcc
cgtggagaaaacgaaagctccttcgggctggaaatgtctcaaattggtttctctactcat
cgactgaaggatggcattctctttgggatggtgggggcctatgactgggggggctcagta
ctatggcttgaggaagaaggtcaccgccttttccccccacggacggccctggaagatgag
tttccccctgcgttgcagaaccatgcagcctacctgggttactccgtttcttccatgttt
ttgcggggtgggcgacgcctctttctctctggggctcctcggtttagacatcgaggaaag
gtcatcgccttccagcttaagaaagatggatggggctgtgcgcggtcgcgccagagcctc
cagggggagcagattggctcatactttggcagtgagctctgcccactggacacagaccgg
gatgggacaacggatgttttactcgtggctgcccccatgttcctgggaccccagaacaag
gagacaggactgtgtgtacgtgtgtactttcgtctcctctctcctcctcgccgccagcag
cccttgctgacattccaggggacactgcagcccgaacccgcccaggacgctcggtttggc
tttgccatgggcgcccttcccgatctgaaccaagatggctttgccgacgtggccgtgggg
gcgcccctggaggatgggcaccgcggggcgctgtacctgtaccatgggacccagaacgga
gtccggcctcgtccggcccagcggattgctgctgtctccatgccacaggccctcagctac
tttggccgaagcgtggacggccggctggacctggacggggacgacctggtggatgtggct
gtgggtgcccaaggggcggccgtcctgctcagctcgcagcccattgtccacctggcgcct
tcactggacgtgagcccgccggccatcagcgtggttcagagggactgcaggcggcggggc
caggaggcggcctgcctgtccgcggccctttgcttccaggtgacatcccgcactcggggc
cgctgggaccgccgattccacttgcggttcacggcatcgctggacgagtggacggctggg
gcccgagcagcgttcgacggctctggccagcggctgtccccgcgccggctccggctcacc
gtggggaacgtcacttgcgagcagctgcacttccacgtgctggatacatcagattacctc
cggccagtggccttgaccgtgaccttcgctttggacaacaccacgaagccagggcccgtg
ctggatgagggctcgcccacctccattcggaagctggtccccttctcaaaggactgtggc
cctgacaatgagtgcgtcacggacctggtgcttctcgctaacatggacatcagaggctcc
agggaggacccgttcctggtgcgaggcgggcggcgcaaagtgctggtgtcggccactctg
gagaacaggatggaaaatgcctacaacacgagcctgcgcctcagcttctcgagaaacctc
cacctggccagcttcacccctcagagggaccggccggtgaaggtggagtgcgcggccccc
gccccccacgcgcggctctgcggcgtggggcatcccgtctttcccaccggggccaaggtg
acctttctgctagagtttgagtttagctgctcctccctcctgagccaggtcctcgtgagg
ctgactgccaccagcagcagccgggagggcagtgggacccttcgggataacacggccgag
gcctcggcctacgtccagtacgagccgcacctcctcttctccagtgagtccactctgcat
cgctatgaggttcacccatatgggaccctcccagtgggtcctggtcctgaattcaaaacc
actctgagggttcagaaccttggctgctatgtggtcagcggcctcatcatctcagccttc
ctcccagccgtggcccatgggggcaactacttcctgtcactgtctcaggtcatcactaac
aatgcaagctgcatagtgcagaacctgaccgagccccccgggccccccgtgcatccagag
gacctgcagcactcgagcagactgaatgggagcaatactcggtgtcaggtcgtgaggtgc
caccttgggtggctcgcgaagggggctgaggtctccgttggactgctgaggctggttcac
aatgaatttttccggaaggccaaattcaagtctgtgactgtggtcagcacctttgagctg
ggagcggaggagggcagcgtcctacagctgaccgaagcctcccggtggagtgagagcctc
ctggaggtgattcagacccgccccatcctcatctcgctgtggatcctcattggcagtgtc
ctgggagggctactgctgctcgctctccttgtcttctgcctgtggaagcttggcttcttt
gcccgtaagaagatccccgaagaagagaaaagagaagaaaaattggagcaatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513835
Entry
107513835         CDS       T06036                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V isoform X1
  KO
K06487  integrin alpha V
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04514  Cell adhesion molecules
ray04810  Regulation of actin cytoskeleton
ray04919  Thyroid hormone signaling pathway
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05222  Small cell lung cancer
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107513835 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107513835 (ITGAV)
   04514 Cell adhesion molecules
    107513835 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107513835 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107513835 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107513835 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107513835 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513835 (ITGAV)
   05205 Proteoglycans in cancer
    107513835 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107513835 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107513835 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    107513835 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107513835 (ITGAV)
   05414 Dilated cardiomyopathy
    107513835 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107513835 (ITGAV)
   05165 Human papillomavirus infection
    107513835 (ITGAV)
Membrane trafficking [BR:ray04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    107513835 (ITGAV)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107513835 (ITGAV)
  Exosomal proteins of epithelial cells
   107513835 (ITGAV)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107513835 (ITGAV)
CD molecules [BR:ray04090]
 Proteins
  107513835 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 107513835
NCBI-ProteinID: XP_016006430
LinkDB
Position
Unknown
AA seq 1048 aa
MASPPPRWLRLRPRRLLLLLAGFLLPMCGAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSHRGCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPKVYSVKYNNQLAT
RTAQAVFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTR
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGKWAAQSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAVLYRARPVITVNAGLEVY
PSILNQDSKTCPLPGTDLKVSCFNVRFCLKADGKGALPTKLNFQVELLLDKLKQKGAIRR
ALFLHNRSPSHSKNMTISRGGQMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
ATGLQPILNQFTPANVSRQAHILLDCGDDNICKPKLEVSVDRDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPPQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSYRVDLAVLTAVEIRGVSSP
DHIFLPIPNWEHKENPETEEDVGPVIQHIYELRNNGPSSFSKAMLNLQWPYKYNNNTLLY
ILQYDIDGPMNCTSDMEINPLRIKVSNSQATEKNDTGFGQGDRNHLITKRDLTQSEGDIH
TLGCGIAECLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDIFNSTLVTTNVTWGIQPTPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggcttctccgccgccgcgatggctgcgccttcgtccccgccgcctcctgctccttctc
gccggattcctgctgcctatgtgcggcgccttcaacctggacgtggacagtcccgccgag
tactccggccccgagggaagttactttggcttcgcggtggatttcttcgtgcccagcgcg
tcttccaggatgtttcttcttgtgggagcacccaaagcaaacactactcagcctgggatt
gtggaaggagggcaagtcctcaagtgtgattggtcttcccaccgcgggtgccagccaatt
gaatttgatgcaacaggcaatcgagattatgccaaggatgatcctttggagtttaagtcc
caccagtggtttggggcatctgtgaggtcaaagcaggataaaatcttggcctgcgcccca
ctgtaccactggaggactgaaatgaaacaggagagagagcctgttggaacatgctttctt
caggatggaacaaagactgtcgagtatgctccatgtagatcaaaaaatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagcttttattggcaaggtcaactgatttcagatcaagtggcagaa
attgtatctaagtatgaccccaaggtgtacagtgtcaagtataataaccagttagcaact
cggactgcacaagctgtttttgatgacagttatttgggttactcggtggctgttggagat
ttcaatggtgacggcatagatgactttgtttcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaagaacatgtcctccttatacaattttactggtgag
cagatggctgcatattttggattttctgtcgctgccactgacattaatggggatgattat
gcagacgtgtttattggagcacctctctttatggatcgtggttctgatggcaaactccaa
gaggtggggcaggtctcagtgtctctgcaaagagcttcaggagacttccagacgaccaga
ttgaatgggtttgaggtctttgcgaggtttggcagtgccatagcacctctgggagatctg
gaccaggacggcttcaatgatattgcaattgctgctccatatggaggcgaagataaaaaa
ggaattgtttatattttcaatggaagatcaacaggcttgaatgcagtaccatctcaaatc
cttgaagggaagtgggctgctcaaagcatgccaccaagctttggctattcaatgaaagga
gccacagatatagacaaaaatggctatccagacttaattgtaggagcttttggtgtagat
agagctgtgttatacagggcccgaccagttatcacagtaaatgctggccttgaagtgtac
cctagcattctcaatcaagacagtaaaacctgtccactgcctgggacagatcttaaagtt
tcctgttttaatgtcaggttctgcttaaaggcagatggcaaaggagcacttcccacgaaa
cttaacttccaggtggagcttcttttggataaactcaagcaaaaaggagcaattcgacga
gcactatttctccataacaggtccccaagtcactctaagaacatgactatttcccgaggg
ggacagatgcagtgtgaggagctgatagcgtatctgcgggatgaatctgaatttagagac
aaactcactccgattactatttttatggagtatcggttggattatagaacagctgctgat
gcaacaggcttgcaacccattcttaaccaattcactcctgccaacgttagtcgacaggct
catattctacttgactgtggtgatgataacatctgtaaacccaaactggaagtttctgta
gatagagatcagaagaagatctatattggggacgacaaccctctgacattgatcgttaag
gctcagaaccaaggagaaggtgcctatgaagctgagctcatcgtttccatcccaccgcag
gctgatttcattggggttgtccgtaacagtgaagccttagcaagactttcttgtgcattt
aagacagaaaaccaaacccgccaggtggtatgcgaccttggaaacccaatgaaagctgga
actcaactcttagccggtctccgtttcagtgtacaccagcaatcagagatggatacttct
gtgaaatttgatttacaaatccaaagctccaatcttttcgacaaagtaagcccagttgta
tcttacagagttgaccttgctgttttaactgctgttgagataagaggagtctcaagtcct
gatcatatctttcttccaattccaaattgggagcacaaggagaaccctgagactgaagaa
gatgttgggccagttattcaacatatctatgagctgaggaacaatggtccaagttcattc
agcaaggcaatgttaaatcttcagtggccttataaatataacaataacactttgttgtac
atcctccaatatgatattgacggaccaatgaactgcacttcagatatggagatcaaccct
ttgagaattaaggtatcaaattcacaagcaactgaaaagaatgacacaggttttgggcaa
ggtgaccggaaccatctcatcactaagcgggatctcacccagagtgaaggagatattcac
actttggggtgtggaattgctgaatgcttgaagattgtctgccaggttgggcgactagac
agaggaaagagtgcaatcctgtatgtaaaatctctgctgtggactgagacctttatgaat
aaggaaaaccagaatcattcatactctctgaagtcatctgcttcttttaatgtcatcgag
tttccttataagaaccttccaattgaggatatcttcaactccacattagttaccactaat
gtcacctggggcattcagccaacaccgatgcctgtgcctgtgtgggtgattattttagca
gttctagcaggattgttgttattggctgttttggtatttgtgatgtacagaatgggattt
tttaaacgtgttcggccacctcaagaagaacaagaaagggaacagcttcaacctcatgaa
aatggtgaaggaaactcagaaacttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517588
Entry
107517588         CDS       T06036                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3
  KO
K06482  integrin alpha 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04640  Hematopoietic cell lineage
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05222  Small cell lung cancer
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107517588 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107517588 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107517588 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107517588 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107517588 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107517588 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    107517588 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107517588 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107517588 (ITGA3)
   05414 Dilated cardiomyopathy
    107517588 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107517588 (ITGA3)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107517588 (ITGA3)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107517588 (ITGA3)
CD molecules [BR:ray04090]
 Proteins
  107517588 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS MLANA
Other DBs
NCBI-GeneID: 107517588
NCBI-ProteinID: XP_016013951
LinkDB
Position
Unknown
AA seq 1051 aa
MGPGLRRATRVPRRMLCALALMVAAGGRIASAFNLDTQFLVVKEARNPGSLFGYSVALHR
QTERRRRYLLLAGAPRDLAVPDGYTNRTGAVYLCPLTANKNDCERMDIREKSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGLEDQRRMVGKCYVRGNDLELDRTDDWQTY
HNEMCNSNTDYLETGMCQLGTSGGFTKNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYK
GPEDQGNLYIGYTVQVGSAILHPTDITIVTGAPRHQHMGAVFLLSQEVGGDLRRRQVLEG
TQVGAYFGGAIALADLNNDGWQDLLVGAPYYFERKKEVGGAIYVFMNQAGTSFPTHPSLL
LHGPSHSAFGFSVASIGDINQDGFQDIAVGAPFEGLGTVYIYHSSSRGLLQQPQQIIHGE
KLRIPGLATFGYSLSGQMDVDENSYPDLLVGSLSDRIVLLRARPVINILHKTLVARPSVL
DPTLCTDTSCVQVKLCFAYNQSAGNPNYRQNITLAYTLEADRDRRPPRLRFAQSQSAVLH
GFFSMPEMRCQTLELLLMDNVRDKLRPIVISMNYSLPLRMPERPKVALQSLDAYPVLNQA
QALENHTEVQFQKECGPDNKCDSNLEMQAAFVSEQGQPISRLQYSRDFGKLLLSINVTNI
RSRQRAGEDAHEAQLTLAVPPALLPSSVRPFGACQGNETILCHLGNPFKRNQRMELLIVF
EVIGVTLHTRELQAQLQLSTSSHQDNLQPMTLTLLVDYTLQASLSMVSRRLQSYFGGTVM
GESGMKTVEDVGSPLKYEFQVGPMGEGLAALGTLVLGLEWPYEVINGKWLLYPTEITIHG
NGSWPCQPPGDLVNPLNLTLSVPGDRLPSSHRRRRQLDPGGGQGPPPATLAVAKKAKSET
LLSCGSDHTRCVWLECPIPDAPVVTNVTVQARVWNSTFIEDYRDFDRIRVTSWATLFLRT
SIPTLNMENKTVRFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFK
RARTRALYEAKRQKAEMKSQPSETERLTEDY
NT seq 3156 nt   +upstreamnt  +downstreamnt
atgggcccgggtctgcgccgcgccacccgcgtcccgcgccggatgctttgcgcgctcgcc
ttgatggtggccgctggcggccgcatcgcctctgctttcaacctggacacccaattcctg
gtggtgaaggaggccaggaacccgggcagcctcttcggctactcggtcgccctccatcgg
cagacggagcggcggcggcgctacctgctcctggctggtgccccccgggaccttgctgtg
cctgatggctataccaaccggaccggtgctgtgtacctgtgcccactcactgccaacaag
aacgactgtgaacggatggacatcagagagaaaagtgaccctgaccatcacataattgag
gacatgtggctgggggtgactgtggccagccagggccctgcaggcagagtcctggtctgt
gcccaccgctacacccaggtgctgtggtcggggctggaggaccagcggcgcatggtgggc
aagtgctatgtgcggggcaatgacctagagctggaccgcactgatgactggcagacctac
cacaacgagatgtgcaacagcaacactgactacctggagacgggcatgtgtcagctgggc
accagtggcggctttaccaagaacactgtgtacttcggtgctcccggtgcctacaattgg
aaaggaaacagctacatgattcagcggaaggactgggatttatccgaatatagttacaag
ggcccagaggaccaaggaaacctctatattgggtacacggtgcaggtgggcagtgccatc
ttgcaccccacggatatcaccattgtgacgggtgccccacggcaccaacatatgggcgct
gtcttcttgctgagccaggaggtaggcggagacctacggaggaggcaggtgctggagggc
acgcaggtgggcgcctattttggcggtgccattgccctggcagacctgaacaatgatggg
tggcaggatctcctggtgggtgccccctactactttgagcggaaaaaggaggtagggggt
gccatctatgtcttcatgaaccaggcaggcacctccttccctacccacccctccctcctt
cttcacggtcctagtcactccgcctttggcttctccgtggccagcattggtgacatcaac
caggatggattccaggacattgctgtgggagctccatttgaaggtttgggaacagtgtac
atctaccacagcagctccagggggcttctccaacagccccagcagataatccacggagag
aagttgagaatacctgggttggccacctttggctactccctgagtgggcagatggatgtg
gatgagaactcctacccggacctgctagtggggagcctttcagaccgcatcgtgcttctg
agggcccggcctgtcatcaacatcctccataagaccttggtggccaggccatctgtgctg
gaccccacactctgcacagacacctcttgtgtgcaggtgaagctgtgctttgcttataac
cagagtgctgggaaccccaactacaggcaaaatatcaccctggcctatacactggaagct
gacagggaccgccgcccaccccgacttcgctttgcgcagagtcagtcagctgtcttgcat
ggcttcttctccatgcctgagatgcgctgccagacgttggagctgctcctgatggacaac
gtccgtgacaaactccgtcccatcgtcatctccatgaactactctttacctttgcgtatg
ccagagcgccccaaggtggcgctgcagtccctggacgcctacccggtcctcaaccaggcg
caggctctggaaaaccacaccgaggtccagttccagaaggagtgtgggccggacaacaag
tgtgacagcaacttggagatgcaggcagcctttgtgtccgagcaggggcagccgatcagc
aggctccaatacagcagagacttcgggaaactgctcttgagcatcaatgtgaccaatatc
cggagcaggcagcgggctggagaagacgcccacgaggcgcagctcaccctggcggtacct
cccgccctgctaccgtcctcagtgcgcccttttggggcctgccaaggcaacgagactatc
ctttgccacctggggaaccccttcaaacggaaccagaggatggagctactcatcgtcttt
gaggtcatcggggtgaccctgcacacaagggagctccaggcacagctgcagctgtccacg
tcaagtcaccaggacaatctgcagcccatgaccctgactttactggtggattatacgctc
caggcctcactcagcatggtgagtcgccggctacaaagctactttggaggaacagtgatg
ggtgagtctggcatgaaaactgtggaggatgtggggagccctctcaagtatgagttccag
gtgggcccaatgggggaagggctggcagccctggggaccctggtgctaggtctggagtgg
ccctatgaagtcatcaacggcaagtggctgctgtaccccacggagatcaccatccatggc
aatgggtcctggccgtgccagccacccggagaccttgtcaatcctctcaacctcactctc
tctgtccctggggataggctgccatcttcacatcgcaggcgaaggcagcttgacccaggg
ggaggccagggccccccacccgccactctggctgttgccaaaaaagccaagtctgagacc
ctgctgagctgcggcagtgaccacacccgctgcgtgtggctggagtgccctattcccgat
gcccctgtcgtcaccaatgtgaccgtgcaggctcgagtgtggaacagcacctttatcgag
gattacagggacttcgaccgaatcagggtaaccagctgggctaccctgttcctccgaacc
agcatccccacccttaacatggagaacaagaccgtgcggttctccgtggacattgactct
gagctggtggaggagcttccagctgagatcgagctgtggctggtgctcgtggctgtaggt
gccgggctgctgctgctggggctcatcatcctcctgctatggaagtgcggcttcttcaag
cgagcccgcactcgcgccctgtatgaagccaagagacagaaggcggagatgaagagccag
ccgtcagaaacagagaggctgaccgaagactactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520625
Entry
107520625         CDS       T06036                                 

Gene name
ITGA4
Definition
(RefSeq) integrin alpha-4
  KO
K06483  integrin alpha 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04514  Cell adhesion molecules
ray04640  Hematopoietic cell lineage
ray04670  Leukocyte transendothelial migration
ray04672  Intestinal immune network for IgA production
ray04810  Regulation of actin cytoskeleton
ray05135  Yersinia infection
ray05140  Leishmaniasis
ray05165  Human papillomavirus infection
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107520625 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107520625 (ITGA4)
   04514 Cell adhesion molecules
    107520625 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107520625 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107520625 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107520625 (ITGA4)
   04670 Leukocyte transendothelial migration
    107520625 (ITGA4)
   04672 Intestinal immune network for IgA production
    107520625 (ITGA4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107520625 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107520625 (ITGA4)
   05414 Dilated cardiomyopathy
    107520625 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107520625 (ITGA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107520625 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    107520625 (ITGA4)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107520625 (ITGA4)
  Exosomal proteins of other cancer cells
   107520625 (ITGA4)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107520625 (ITGA4)
CD molecules [BR:ray04090]
 Proteins
  107520625 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha URO-D DUF11
Other DBs
NCBI-GeneID: 107520625
NCBI-ProteinID: XP_016020096
LinkDB
Position
Unknown
AA seq 1035 aa
MAEEARSGPGPRRAAVPEAVMLLLCLGVRSGRPYNVDTESALLYQGAPNTLFGYSVVLHS
HGENRWLIVGAPTANWLANSSVVNPGAIYRCVIGKNPNRTCEQLQLGSPGGEPCGKTCLE
ERDNQWLGVTLSRQPGINGSIVTCGHRWKNIFYIKNENKLPSGVCYGVPSDLRTKLSRRI
APCYRDFVKTFGENFASCQAGISSFYTEDLIVMGAPGSFFWTGSLFIYDITTNKYKAFLD
KDNQVKFGSYLGYSVGAGHFRSRHTTEVVGGAPQHEQIGKAYIFSIGATELSILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSIIREEGRVFVYINSGSGTVMNEMETELIG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLRGAIYIYNGRADGISSVFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDIAVGAFRSDSVVLLRTRPVVVVEASLNHPESVN
RTNFDCIENGLPSVCMDLTLCFSYKGKKVPGYIVLVYNMSLDVNRKAETPSRFYFSSNGT
SDVITGSMKVSSTVANCRTHQAFMRKDVRDILTPIQIAAAYHLGHHVISKRSTEEFPPLQ
PILQQKNKKDIIEKTINFARFCAHENCSADLQISAKFELSRPHENKTYLVVGSVKTLMLN
VSLFNAGDDAYETTLHIKLPTGLYFIKILDLEEKQINCEVTDSSGIVKLDCSVGYIFVDH
LSRIDVSFLLDASSLSRAEEDLNITVHATCENEGVTDNLKHNKVTVVVPLKYEVMLAVHG
SVNPNSFVYGPEEDSETETCMAEKMNFTFHVINTGHSVAPNVSVEIMVPNSFIPQTDKLF
NILDVQTTTGECHFKNYERKCSSEQQKGAKDILKDFFRVLSKTDKRLLYCLKADPHCLNF
LCNFGKMESGKEVSVHIHLEGRPSILEMDETAALTFEIRATAFPEPNPKVIELNKDENIA
HVLLEGLHHQRPKRLFNVVIIVSSLFFGLLLLLLISYVMWKAGFFKRQYKSILQEENRRE
SWSYINSKSNDDDDE
NT seq 3108 nt   +upstreamnt  +downstreamnt
atggccgaggaagcgaggagcgggccgggcccccgaagggccgccgtcccggaggcggtg
atgctgctgctgtgcctgggggtccggagcgggcgcccttacaacgtggacaccgagagc
gcgctgctctaccagggcgcccccaacaccctgtttggctactcggtagtgctgcacagc
cacggggagaaccgatggctcatagtgggggcgcccacggccaactggctcgccaattct
tctgtggtcaatcccggggcgatttacagatgcgtaatcggaaagaatccaaatcggaca
tgcgaacagctccagctgggtagccctggtggagaaccttgtggaaagacttgtttggaa
gaaagagacaatcaatggttgggagtcacactttccagacagccaggaataaatggatcc
atcgtgacttgtgggcatagatggaaaaatatattttatataaagaatgaaaataaactt
ccttctggtgtttgctatggagtaccctctgatttaagaacaaaactgagtagaagaata
gctccatgttatcgagattttgtgaaaacatttggagaaaattttgcatcatgtcaagct
ggaatatctagtttttacacagaggatttaattgtgatgggtgccccaggatcgtttttt
tggactggctctctttttatctacgatataactacaaataaatacaaggcttttttagac
aaagacaatcaagtaaaatttggaagttacttaggatactcggttggagccggtcatttt
cgcagtaggcatactaccgaagtagttggaggagcccctcaacatgagcagattggtaaa
gcatacatattcagcattggtgcaacagaactaagtatcttacatgaaatgaaaggtaaa
aagcttggctcttattttggagcttctgtctgtgctgtggacctcaatgcagatggcttc
tcagacctgctcgtgggagctcccatgcagagcatcatcagggaggaaggaagagtgttc
gtgtacatcaattctggctcgggaacagtaatgaatgagatggaaacagaactcattgga
agtgacaaatatgctgcaagatttggagaatctatagttaatcttggtgacattgataat
gatggctttgaagatgtcgctattggagctccacaagaagatgacttgagaggtgctatt
tatatttacaatggccgagcagatgggatctcatcagtcttttcacagagaattgaagga
cttcaaatcagcaaatcattaagtatgtttggacagtctatatctgggcaaattgatgca
gataataatggatatgtagatatagcagttggtgcttttcggtctgattctgttgtgttg
ctaaggacaagacctgtagtggttgtcgaagcttctttaaaccatcccgagtcagtaaac
agaacgaattttgactgtatagaaaacggattgccttctgtgtgcatggatttaacactc
tgtttctcatacaagggcaaaaaggttccaggctatattgttttggtttataacatgagt
ctagatgtgaacaggaaggcagaaactccatcgagattttacttttcttctaatggaact
tctgatgtgattacaggaagcatgaaagtatcgagcacagtggctaactgtagaacacat
caagcgtttatgcggaaagatgtgcgagacatcctcacaccgattcagattgcagctgct
taccaccttgggcaccatgtcatcagtaagcgaagtacagaggaattcccaccacttcag
ccaattcttcagcagaagaacaaaaaagacataattgaaaaaacaataaactttgcaagg
ttttgtgctcatgaaaattgttctgctgacttacagatttctgcaaaatttgaactttcg
aggccacatgaaaataaaacctatcttgttgttggaagtgtgaagacattaatgttgaac
gtgtccttgtttaatgctggagatgatgcatatgaaacaactctgcatatcaaactaccc
actggtctttacttcattaagattttagatctggaagagaagcaaataaactgcgaagta
acagacagctctggcatagtaaaacttgactgcagtgttggttatatatttgtagatcat
ctctcaaggatagatgttagctttctcctggatgcgagctcactcagcagagcagaagag
gatctcaacatcacagtgcacgccacctgtgaaaacgaaggggtcacagacaatctgaag
cataacaaagtgactgtagtggtgcccctgaagtatgaagtcatgctagctgttcacggg
tctgtaaacccaaattcgtttgtgtatggaccagaggaggacagtgagactgaaacatgc
atggcagagaaaatgaacttcactttccacgttatcaataccggccatagcgtggctcca
aatgttagtgtggagataatggtaccaaattcttttatcccccaaaccgataagttgttc
aacattttggatgtccagactactactggcgaatgccattttaaaaattatgaaagaaag
tgttcatcagagcagcagaaaggtgcaaaggacatcttgaaagacttcttcagagtcttg
tcgaagaccgataagaggcttctgtactgcctaaaagctgatccacattgtttaaacttc
ttatgcaattttgggaaaatggaaagtggaaaagaagtcagtgttcacattcacttagag
ggtcggccatccattttagaaatggatgagactgcagcactcacgtttgaaataagagca
acagcttttccagaaccaaatccaaaagttattgaactaaacaaggatgagaacattgca
catgttctgcttgaaggactacatcatcaaagacccaaacgtcttttcaatgtagtgatt
attgtaagcagcttgttctttggacttcttctacttttactgatttcatatgttatgtgg
aaggctggcttctttaaaagacagtacaaatccatcctacaagaagaaaacagaagagag
agttggagttacattaacagtaaaagcaatgatgatgacgatgagtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521082
Entry
107521082         CDS       T06036                                 

Gene name
ITGA5
Definition
(RefSeq) integrin alpha-5 isoform X1
  KO
K06484  integrin alpha 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04145  Phagosome
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04640  Hematopoietic cell lineage
ray04810  Regulation of actin cytoskeleton
ray05100  Bacterial invasion of epithelial cells
ray05133  Pertussis
ray05135  Yersinia infection
ray05165  Human papillomavirus infection
ray05168  Herpes simplex virus 1 infection
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107521082 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107521082 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107521082 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107521082 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107521082 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107521082 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107521082 (ITGA5)
   05205 Proteoglycans in cancer
    107521082 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107521082 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107521082 (ITGA5)
   05414 Dilated cardiomyopathy
    107521082 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107521082 (ITGA5)
   05133 Pertussis
    107521082 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    107521082 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107521082 (ITGA5)
   05165 Human papillomavirus infection
    107521082 (ITGA5)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107521082 (ITGA5)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107521082 (ITGA5)
CD molecules [BR:ray04090]
 Proteins
  107521082 (ITGA5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 107521082
NCBI-ProteinID: XP_016020994
LinkDB
Position
Unknown
AA seq 1105 aa
MPPLPPPPRQAGEGLSREFGKLLPALSHSPLGGLGSGSGSVAPGQGRAGAMGSRTLRSPL
HAVQPRWGPRRRHPLLPLLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEF
YRPWTNGVSVLVGAPKANTSQPGVLQGGAVYLCPWSTSLAQCTPIEFDSKGSRILESSLS
IPEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTENFTRI
LEYAPCRSDFSWAAGQGYCQGGFSAEFTKNGRVVLGGPGSYFWQGQILSATQEQIAESYY
PEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTIL
NGSDIRSLYNFSGEQMASYFGYAVAVSDVNGDGLDDLLVGAPLLMERTADGRPQEVGRVY
VYLQQPTGMEPTPTLTLTGHDEFGRFGSSLTPLGDLDRDGYNDVAIGAPFGGETQQGVVF
VFPGGLGGLGSKPSQVLLPLWAAGHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVV
YRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVPDSIGFTVEL
QLDWQKQKGGIRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHI
ALNFSLDPQAPVDSHGLQPVLHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHV
YLGDKNSLNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQS
RLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSEVVSFRLSV
EAQAQVSLNGVSKPEAVLFPVSDWHPRDKPQKEGDVGPAVHHVYELINLGPSSISRGMLE
LSCPKTLEGQQLLYMTKFTGLSNCTTSHLPNSEHLELDPEGSQNHRLQRREAPGQSPASS
WPQILKCPEVECFRLRCELGPLHRQESRSLQLHFRVGAKTFLQREHQPFSLQCEAVYEAL
KMPYRILPRQLPRKELQVATAVQWTKAEGSHGVPLWIIILAILIGLLLLGLLIYILYKLG
FFKRSLPYGTAMEKAQLKPPATSDA
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgccccccctcccaccacccccccgacaggcgggggaagggctcagccgggagtttggc
aaactcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcg
gtggccccaggacagggaagagcgggcgctatggggagccggacgctaaggtcccctctc
catgctgtgcagccgcgctggggcccccggcgccgacacccgctgctgccgctgctgctg
ccgctgctgctactactgctgccgccgccacccagggtcgggggcttcaacttagacgcg
gaggccccagcagtgctctctgggcccccaggctccttctttggcttctccgtagagttt
taccggccgtggacaaacggggtcagtgtgctggtgggagcacccaaggctaacaccagc
cagccaggagtgctgcagggcggtgctgtctacctctgtccctggagcaccagcctggca
cagtgtacccctattgagtttgacagcaaaggatctcggatcctggagtcctcactctcc
atcccagagggagaggaacctgtggagtacaagtccttgcagtggtttggagcaacagtt
cgagcccatggctcctccatcttggcctgcgctccactgtatagctggcgcacggagaag
gagcctctgagcgatcccgtgggcacctgctacctctccacagaaaacttcacccgaatc
ctagagtacgcaccttgccgctcagatttcagctgggcagcaggacagggttactgccaa
gggggcttcagtgctgagtttaccaagaatgggcgcgtggtcctcggtggaccagggagt
tatttctggcaaggccaaatcctgtccgccacccaggagcagattgcagaatcctattac
cccgagtacctgatcaacctcgttcaggggcagctgcagactcgccaggccagctccatc
tatgatgacagctatctgggttactctgtggccgtgggtgaattcagtggtgatgacaca
gaagactttgttgctggtgtgcccaaagggaaccttacctatggttatgtcaccatcctt
aatggctcagacattcgatccctctacaacttctcaggggaacagatggcctcctacttt
ggctatgcagtggctgtctcagatgtcaatggagatgggctggatgacttgctggtgggg
gctccgctgctcatggagaggacagcagatgggcggcctcaggaggtaggcagggtctat
gtctacctgcagcagccaacaggcatggagcccacgcccaccctcaccctcactggccat
gatgagtttggccgatttggaagctccttgacaccactgggggacctggacagggacggc
tacaatgatgtggccattggggctccctttggtggggagacacagcaaggagtggtgttc
gtgttccctgggggcttaggggggctgggctctaagccttcccaggttctgctgccccta
tgggcagctggccacacgccagacttttttggctctgcccttcgaggaggccgagacttg
gatggcaacggataccctgatctgattgtggggtcctttggtgtggacaaggctgtggtg
tacaggggtcgtcccatcgtgtctgccagtgcctccctcaccatcttccccgcaatgttc
aacccagaggagcgtagctgcagtttggagggaaaccctgtggcgtgcatcaaccttagc
ttctgcctcaatgcctctggaaaacatgttcctgactccatcggcttcacggtggagctc
cagctggactggcagaagcagaagggaggaatacggcgagctctattcctagcctccaga
caggcaaccctgacccagaccctgctcatccagaacggggctcgggaggattgcagagag
atgaagatctacctcaggaacgagtcagagttccgagacaaactctccccgattcacatc
gccctcaacttctccctggacccccaagcccccgtggacagccatggcctccaacccgtc
ttacattaccagagcaagagccgcatagaggacaaggctcagattctgctggactgtggg
gaagacaacatttgtgtgccagacttacaactggaagtgtttggggagcagaaccacgtg
tacctgggtgacaagaactctctgaatttaactttccacgcccagaatgtgggtgagggt
ggcgcctatgaggctgagcttcgggtcacagctcctcctgaagctgagtactcaggactc
gtcagacacccagggaacttctccagcctgagctgcgactactttgcggtgaaccagagc
cgcctactggtgtgtgacctgggcaaccccatgaaggcaggagctagtctctggggtggc
cttcggttcacagtccctcacctccgggacacaaagaaaacgatccaatttgacttccag
atcctcagcaagaatctcaacaactcgcaaagtgaagtggtttccttccggctctcagtg
gaagctcaggcccaggtctcccttaacggtgtctccaagcctgaagcagtgctattccca
gtgagcgactggcatccccgagacaagcctcagaaggagggggacgtgggccctgctgta
caccacgtctatgagctcatcaacctgggccccagctccattagccggggcatgctagag
ctcagctgtcccaagactctggaagggcagcagctcctctacatgaccaagtttacggga
ctcagcaactgtactaccagtcacctccccaactcagagcacctggagttggatcccgag
ggttcccagaaccacaggctgcaaagacgagaagctccaggccagagccctgcctcctca
tggcctcagattctgaaatgcccagaggtggagtgtttcaggctgcgctgtgagctcggg
ccactccatcggcaagagagcagaagtctgcaactgcatttccgagttggggccaagacc
ttcctgcagcgggagcaccagccatttagcctgcagtgtgaagctgtgtatgaagccctg
aagatgccctacagaatcctgcctcggcaacttccccgaaaggaacttcaggtggccaca
gctgtgcagtggaccaaggcagaaggcagccacggtgtcccactgtggattattatccta
gccattctcattggcctcctgctcctaggtctgctcatctacatcctctacaagctcgga
ttcttcaaacgctccctcccatatggcaccgccatggaaaaggctcagctcaagcctccg
gccacctctgatgcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521260
Entry
107521260         CDS       T06036                                 

Gene name
ITGA7
Definition
(RefSeq) integrin alpha-7 isoform X1
  KO
K06583  integrin alpha 7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04151  PI3K-Akt signaling pathway
ray04510  Focal adhesion
ray04512  ECM-receptor interaction
ray04810  Regulation of actin cytoskeleton
ray05165  Human papillomavirus infection
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107521260 (ITGA7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107521260 (ITGA7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107521260 (ITGA7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107521260 (ITGA7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107521260 (ITGA7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107521260 (ITGA7)
   05414 Dilated cardiomyopathy
    107521260 (ITGA7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107521260 (ITGA7)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107521260 (ITGA7)
Cell adhesion molecules [BR:ray04515]
 Integrins
  Integrin alpha subunits
   107521260 (ITGA7)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS DUF3488 Integrin_alpha HCO3_cotransp
Other DBs
NCBI-GeneID: 107521260
NCBI-ProteinID: XP_016021283
LinkDB
Position
Unknown
AA seq 1163 aa
MAGISGRDPMRVSGICYLLGSLLLGLLSPGAVAFNLDVMGALRKEGEPESLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADVQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDVIGRCFVLSQDLAIHDELDGGE
WKFCEGRPQGHEQFGFCQQGAAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSADLAH
LDDGPYEAGGLLFVTNIDSSDPDQLVYKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLV
RAEELSFVAGAPRANHKGAVVILRKDSASRLVPEVMLSGERLTSGFGYSLAVADLNNDGW
ADLVVGAPYFFERQEELGGAVYVYMNQGGHWAGVSPLRLCGSPESMFGISLAVLGDLNQD
GFPDIAVGAPFDGDGKVFIYHGSSLGVVVKPSQVLEGEAVGIKSFGYSLSGGLDVDGNHY
PDLLVGSLADTAVLFRARPVLHVSHEVFIAPRNIDLEQPNCAGGRSVCVDLRVCFSYIAV
PSSYNPIVALDYVLDGDTDRRLRGQVPRVTFLSRGLDDPKHQASGTVWLKHQHDRVCGDT
MFQLQENVKDKLRTIVVTLSYSLQTPRLRRQASSQGLPPVAPILNAHQPSTQRAEIHFLK
QGCGEDKICQSNLQLVHARFCARVSDTEFQPLPMDVDGTTALFALSGQPFIGLELKVTNL
PSDPAQPQADGDDAHEAQLLVNLPASLHYSGVRALDPAEKPLCLSNENASHVECELGNPM
KRDAQITFYLILSTSGITIETTELEVELLLATISEQELHPVSARARVFIELPLSITGVAI
PQQLFFSGVVRGESAMRSERDVGSKVKYEVTVSNQGQSLNTLGSAFLNIMWPHEIANGKW
LLYPMRVELEGGHGPGPKGLCSPRPNILHLDVDNRDRRRRELEQPRQQEPHEQLEPSTSW
WPVSSAEKKKNVTLDCAWNTANCIVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSL
EVIVRANITVKSSIKNLVLRDASTVIPVMVYLDPVAVVAEGVPWWVILLAVLAGLLVLAL
LVLLMWKMGFFKRARYPEATVPQYHAVKIPREDRQQFKEEKTGTILRSNWGSPRREGPDA
HPILAADGHPELGSDGHSGPGTA
NT seq 3492 nt   +upstreamnt  +downstreamnt
atggccggcatttcgggccgcgatcctatgcgggtctccgggatttgttaccttcttggt
tccctgctcctcggactgctctccccaggggctgttgccttcaatctggatgtgatgggc
gcgctgagaaaggagggagagccagagagcctctttggcttctccgtggctctgcatcgg
cagttacagccccgaccccagagctggctgctcgtaggtgctcctcaggccctggctctg
cctgggcagcaggcgaaccgcactggaggcctcttcgcttgccccctgagcctggaggag
actgactgctacagagtggacatcgaccagggagctgatgtgcagaaggagagcaaggag
aaccagtggttgggagttagtgttcggagccaggggcccgggggaaagattgtcacctgt
gcacaccggtatgaggcgaggcaacgagtggaccagatcctggagacaagggacgtgatt
ggtcgctgctttgtgctaagccaggacctggccatccatgatgagttggatggtggggag
tggaagttctgtgaggggcgcccccagggccacgaacagtttgggttctgccagcagggc
gcagctgctgccttctcccccgacagccactacctcctctttggggccccgggaacctat
aactggaagggcactgccagggtggagctctgtgcacagggctcagcggacctggcccac
ctcgacgacgggccctacgaggcgggggggttgctctttgtgaccaacattgatagctca
gaccctgaccagctggtgtataaaactttggaccctgctgaccggctcccaggaccagcc
ggagacttggccctgaatagctacttaggtttctccattgactctgggaagggcctggtg
cgtgcagaggagctgagctttgtggctggggccccccgtgccaaccacaagggtgctgtg
gttattctgcgtaaagatagtgccagtcgcttggtgccggaagttatgctgtccggggag
cgcctgacctctggctttggctactcactggcagtggctgatctcaacaatgacggctgg
gcagacctggtagtaggtgccccctacttctttgagcgccaagaagagctggggggtgct
gtgtatgtgtacatgaaccaagggggtcactgggctggggtctcccctctccggctctgt
ggctcccccgaatccatgtttgggatcagcctggctgtcctgggggacctcaaccaagat
ggcttcccagatatcgctgtgggcgctccctttgatggggatgggaaagtctttatctac
cacgggagcagtctaggggtcgttgtcaaaccttcccaggtgctggagggcgaggctgtg
ggcataaagagctttggctactctctgtctggtggcctggatgtggacgggaatcattac
cccgacctgctggtgggctccctggccgacactgctgtgcttttcagggccagacctgtc
ctccatgtctcccatgaggtctttattgctccacgaaacattgacctagaacagcccaac
tgtgctggtggccgctcagtctgtgtggacctaagggtctgtttcagctacattgcagtc
cccagcagctacaacccgattgtggccctggattatgtgttagatggggacacagaccgc
aggctccggggccaggtcccccgtgtgaccttcctgagccgtggcctggatgaccccaag
caccaggcttcaggcaccgtgtggctgaagcaccagcatgaccgagtctgcggagacacc
atgttccagttacaggagaacgtcaaagacaagcttcggaccattgtggtgaccctgtcc
tatagcctccagacccctcggctccgacgacaggcatctagccagggactgcccccagtg
gcccccattctcaatgcccaccagcccagcacccagcgggcagaaatccacttcctgaag
caaggctgtggtgaagataagatctgccagagcaatctacagctggtccatgcccgcttc
tgtgcccgggtcagcgatacagaattccagcctctgcccatggatgtggatgggacaaca
gccctgtttgcactgagtgggcagcctttcattggcctggagttgaaggtaaccaacctg
ccctcggacccagcccagccccaggccgatggggatgatgcccatgaagcccagctcctg
gtcaacctccctgcttctctgcactactcaggagtgcgggccctggatcctgcggagaag
ccactgtgcctgtccaatgagaatgcctcccatgttgagtgtgagctggggaaccccatg
aagagagacgcccagatcaccttctatctcatcctcagcacctcagggatcaccattgag
accacggagctggaggtggagttgctgttggccacgatcagtgagcaggagctgcatccc
gtctctgcccgggcccgtgtcttcattgagctgccactatccatcaccggggtggccatt
ccccagcagctcttcttctctggcgtggtacggggtgagagtgccatgcggtctgagagg
gatgtgggcagcaaggtcaagtatgaggtcacggtctccaaccagggccagtcactcaac
accctgggctctgcattcctcaacatcatgtggccccacgagattgccaacggaaagtgg
ctgctgtaccccatgcgggtggagctggagggcgggcatgggcctgggccgaaggggctc
tgttctcccaggcccaacatcctccacctggatgtagacaacagggacaggaggcggcgg
gagctggagcagccaaggcaacaggaacctcatgagcagctggagcctagcacatcctgg
tggccagtgtcctctgctgagaagaagaaaaatgtcaccctggactgtgcctggaacaca
gccaactgcatagtattcagctgtccactctacagctttgaccgtgcggctgtgctgcat
gtgtggggtcgcctctggaacagcaccttcctggaggagtactcagctgtgaagtccctg
gaagtgatcgtccgtgccaacatcactgtgaagtcttcaatcaagaacttggtgctcaga
gatgcctcaacagtgattccagtgatggtatacttggacccggtggctgtggtggcagag
ggagtcccctggtgggtcatcctcctggctgtactggctgggctgctggtgttggcgttg
ctggtgcttctcatgtggaagatgggattcttcaagcgggcgcggtaccccgaggccacc
gtgccccaataccatgcggtgaagatcccgcgggaagaccgacagcagttcaaggaggag
aagacgggtaccatcctgaggagcaactggggcagcccccgacgggagggccctgacgct
caccccatcctggctgctgacgggcacccagagctgggctccgacgggcactctgggcca
ggcactgcctag

DBGET integrated database retrieval system