KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499637
Entry
107499637         CDS       T06036                                 

Gene name
ACVR2B
Definition
(RefSeq) activin receptor type-2B isoform X1
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04350  TGF-beta signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107499637 (ACVR2B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107499637 (ACVR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107499637 (ACVR2B)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107499637 (ACVR2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107499637 (ACVR2B)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107499637 (ACVR2B)
Protein kinases [BR:ray01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107499637 (ACVR2B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp Pkinase_fungal
Other DBs
NCBI-GeneID: 107499637
NCBI-ProteinID: XP_015979523
LinkDB
Position
Unknown
AA seq 512 aa
MTAPWAALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
GPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLLVLLAFWMYRHRKAPYGHVDIHEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMK
HENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ
HPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVAL
IRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgacggcgccctgggcggccctcgctctcctctggggatcgctgtgcgcgggttccggg
cgcggggaggctgagacgcgggagtgcatctactacaacgccaactgggagctggagcgc
accaaccagagcggcctggagcgctgcgagggcgagcaggacaagcggctgcactgctac
gcgtcctggcgcaacagctccggcaccatcgagctcgtcaagaagggctgctggctggac
gacttcaactgctacgacaggcaggagtgtgtggccaccgaggagaacccccaggtgtac
ttctgctgctgcgagggcaacttctgcaatgagcgcttcacccatctgcctgaggccggg
ggcccagaagtcacgtacgagccacccccgacagcccccaccctgctcacggtgctggcc
tactcgctgctgcccattgggggcctctccctcctcgtcctgctggccttctggatgtac
cggcatcgaaaagccccctatggccacgtggacatccatgaggaccctggacctccaccc
ccatcccctctggtgggcctgaagccactgcagctgctggagatcaaggctcgggggcgc
tttggttgtgtctggaaggcccaactcatgaatgacttcgtggctgtcaagatcttccca
ctccaggacaagcagtcgtggcagagtgagcgggagatcttcagcacgcccggcatgaag
cacgagaacctgctgcagttcattgctgccgagaaacgaggctccaacctcgaggtggag
ctgtggctcatcacggccttccacgacaagggctccctcacggattacctcaaggggaac
atcatcacgtggaacgagctgtgtcacgtggcagagacgatgtcaagaggtctctcctac
ctgcacgaggacgtgccctggtgccgtggtgagggccacaagccgtctatcgcgcacagg
gactttaaaagcaagaatgtattgctgaaaagcgacctcacagccgtgctggctgacttt
ggcctggctgttcggtttgagccagggaaacctccaggggacacccacgggcaggtgggc
acacggcggtacatggcccctgaggtactcgagggagccatcaacttccagagggacgcc
ttcctgcgcattgacatgtatgccatggggctggtgctctgggagctcgtctcccgctgc
aaggctgcggatggcccggtggacgagtacatgctgcccttcgaggaagagatcggccag
cacccctcgctggaggagctgcaggaggtggtggtgcacaagaagatgcggcccaccatt
aaggatcactggctgaagcacccgggcctggcccagctctgcgtgaccatcgaggagtgc
tgggaccacgatgcagaggcccgcctgtctgcaggctgtgtggaggaacgggtggctctg
atccggaggtcggtcaacggcactacctcggactgtctcgtctccctggtgacctctgtc
accaacgtggacctgccccctaaagagtcgagcatctga

DBGET integrated database retrieval system