KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499669
Entry
107499669         CDS       T06036                                 

Gene name
MMP2
Definition
(RefSeq) 72 kDa type IV collagenase
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04670  Leukocyte transendothelial migration
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04926  Relaxin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05219  Bladder cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107499669 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107499669 (MMP2)
   04915 Estrogen signaling pathway
    107499669 (MMP2)
   04926 Relaxin signaling pathway
    107499669 (MMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107499669 (MMP2)
   05205 Proteoglycans in cancer
    107499669 (MMP2)
  09162 Cancer: specific types
   05219 Bladder cancer
    107499669 (MMP2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107499669 (MMP2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107499669 (MMP2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107499669 (MMP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ray01002]
    107499669 (MMP2)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     107499669 (MMP2)
Peptidases and inhibitors [BR:ray01002]
 Metallo peptidases
  Family M10
   107499669 (MMP2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 Reprolysin_4
Other DBs
NCBI-GeneID: 107499669
NCBI-ProteinID: XP_015979592
LinkDB
Position
Unknown
AA seq 586 aa
MQKFFGLPQTGALDQRTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLD
PETVDDAFSRAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFA
PGPGVGGDSHFDDDEMWTLGEGQVVRVKYGNADGEFCKFPFLFNGKEYTSCTDSGRSDGF
LWCSTTYDFDKDGKYGFCPHEALLTLGGNADGQPCKFPFRFQGTSYNSCTTEGRTDGYRW
CSTTEDYDRDKKYGFCPETVMSTVGGNSEGAPCIFPFTFLGKKHERCTSEGRGDGKLWCS
TTDSYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGALMAPIYTYTKNFRLSQD
DIKGIQDLYGVSPDTDAGTGTGPTPTLGPVTPELCTQDIIFDGIAQIRGEIFFFKDRFIW
RTVTPQNKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPK
PLTSLGLPPDVERVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADSWTAVP
DNLDAVVDLQGGGHSYFFKGAFYLKLDNQSLKSVKFGGIKSDWLGC
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgcagaagttctttgggctgccccagacgggcgccctggaccagcgcaccatcgagacg
atgcggaagccacgctgcggtaacccggacgtggccaactacaacttcttcccccgcaag
cccaagtgggacaagaaccagatcacgtacaggatcatcggctacacgcccgacctcgat
cccgagacggtggacgatgccttctctcgtgccttccaagtctggagtgacgtgacccct
ctacgcttctctcgtatccatgacggagaggctgacatcatgatcaacttcggccgctgg
gagcatggcgatgggtaccccttcgatggcaaggacggactcttggcacacgcctttgcc
ccgggtcctggtgttgggggagactctcactttgacgacgatgagatgtggaccctggga
gaagggcaagtggtccgcgtgaagtacgggaacgctgacggggagttctgcaagttccct
ttcctgttcaacggcaaggagtacaccagctgcaccgactcgggccgcagcgacggcttc
ctctggtgctctaccacctacgacttcgacaaggacggcaaatatggcttctgcccccac
gaagccctgctcaccctaggtggcaacgcggacggacagccctgcaagttcccgttccgt
ttccagggcaccagctacaacagctgcaccaccgagggccgcacggacggctaccgctgg
tgcagcaccacggaggactacgaccgcgacaagaagtacggcttctgcccagagaccgtc
atgtccactgttggcgggaactcggaaggcgcgccttgcatcttccccttcaccttcctg
ggcaaaaagcacgagcgctgcaccagcgaaggccgcggcgacggcaagctgtggtgctcc
accacggacagctacgacgacgaccgcaagtggggcttctgccccgaccaagggtacagc
ctgttcctggtggcagcccatgagtttggccatgccatgggcttggagcactcagaggac
ccaggagccctaatggcacccatttacacctacaccaagaacttccgcctgtcccaggat
gacatcaagggcattcaagacctctacggggtgtcccctgacaccgatgctggcactggc
accggccctacccccacactgggaccagtcactccggagctgtgcacacaggacatcatc
tttgatggcatcgctcagatccgtggggagatcttcttcttcaaggaccggttcatctgg
cggacggtgacaccacagaacaagcccatggggcccctactggtggccacattctggcct
gagctcccggaaaagatcgatgctgtgtatgaggccccgcaggaggagaaggctgtgttc
tttgcagggaatgaatactgggtctattcagccagcacgctggagcgagggtaccccaag
ccgctgaccagcctggggctgccccctgatgtcgaacgcgtggatgccgccttcaactgg
agcaagaacaagaagacgtacatcttcgctggagacaagttctggagatacaatgaggtg
aagaagaaaatggatcccggcttccccaagctcatcgcggactcctggactgctgtcccc
gataacctggacgctgtggtggacctgcaaggtggcggtcatagctatttcttcaagggc
gcattttatctgaagctggataaccaaagtctgaagagtgtcaagttcggaggcatcaaa
tctgattggctgggttgctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514536
Entry
107514536         CDS       T06036                                 

Gene name
MMP9
Definition
(RefSeq) matrix metalloproteinase-9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04657  IL-17 signaling pathway
ray04668  TNF signaling pathway
ray04670  Leukocyte transendothelial migration
ray04915  Estrogen signaling pathway
ray04926  Relaxin signaling pathway
ray05161  Hepatitis B
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05215  Prostate cancer
ray05219  Bladder cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    107514536 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107514536 (MMP9)
   04670 Leukocyte transendothelial migration
    107514536 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107514536 (MMP9)
   04926 Relaxin signaling pathway
    107514536 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514536 (MMP9)
   05202 Transcriptional misregulation in cancer
    107514536 (MMP9)
   05206 MicroRNAs in cancer
    107514536 (MMP9)
   05205 Proteoglycans in cancer
    107514536 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    107514536 (MMP9)
   05215 Prostate cancer
    107514536 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107514536 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107514536 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107514536 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ray01002]
    107514536 (MMP9)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     107514536 (MMP9)
Peptidases and inhibitors [BR:ray01002]
 Metallo peptidases
  Family M10
   107514536 (MMP9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_4 DUF4953 Reprolysin_3 Peptidase_M66
Other DBs
NCBI-GeneID: 107514536
NCBI-ProteinID: XP_016007832
LinkDB
Position
Unknown
AA seq 708 aa
MSPWLPLVLAFLVLGCCSAAPKRHRPTFVVFPGELRSNRTDTQLAEEYLFRYGYTKVAEL
RDNKQSLGRALRVLQRRLNLPVTGELDSATLEAMRAPRCGVPDLGRFQTFEGDLKWHHQN
ITYWIQNYSEDLPRDVIDDAFARAFAVWSAVTPLTFTRVYGLEADIVIQFGVREHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVGTRFGNADGAPCRFPFTFEGRS
YSACTTEGRSDDLPWCSTTGDFDADGRFGFCPSERLYTEHGNADGKPCVFPFTFEGRSYS
ACTTDGRSDGNRWCATTASYDQDKLYGFCPTRADSTVTGGNSAGEQCVFPFVFLGKEYSS
CTREGRDDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSTVPEALMF
PMYSYTEKPPLHEDDVQGIQHLYGSGPKPEPRPPTTAPETQPTAPPTVCITGPPTARPSE
SPTTGPTGPPSTGPTGPPTASPSAAATASLNPEEDVCNVNIFDAIAEIGNHLHFFKDGKY
WRFSEDQERKVQGPFLIRNTWPALPSKLDSAFEEPLTKKIFFFSGRQVWVYTGTSVLGPR
RLDKLGFGPEVTQITGALSHGEGKMLLFSRQNFWRFDVKTQMVDPKSASPVDQMFPGVPL
DMHDIFQYREKAYFCQDRFYWRMSFQNEVGQVDEVGYVTFDLLQCSEA
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgagcccctggctgcccctggtcttggcgttcctggtgctgggctgctgctctgccgcc
cccaaacggcaccggcccacttttgtggtcttcccaggagaactgagaagcaatcgcact
gacacacagctggcagaggagtatttgttccgttatggctacactaaagtggccgagctt
agagacaacaagcagtccctggggcgggctctgcgggtcctccaaaggcgcctgaacctg
ccggtaactggtgagctggacagcgccaccctggaggccatgcgcgccccgcgctgcggc
gtgccagacctgggcagattccagaccttcgagggcgacctcaagtggcaccaccaaaac
atcacgtactggatccaaaactactcggaagacttgccgcgcgacgtgatcgacgacgcc
ttcgcgcgcgctttcgcggtctggagcgcggtgacgccgctcaccttcacgcgcgtgtac
ggcctggaagccgacatcgtcatccagttcggcgttagggagcacggagatggatatccc
ttcgatgggaaggacgggctcctggcgcacgcctttccccctggcccgggcatccaggga
gacgcccacttcgacgacgaggagctgtggtctctgggcaagggcgtcgtggtagggacc
cgtttcggaaacgcagatggagccccctgtcgcttccccttcaccttcgagggccgctcc
tactccgcctgcaccacggagggccgctcggacgacctgccctggtgcagcaccactggc
gacttcgacgctgacggccggttcggcttctgcccgagcgagagactctacaccgagcac
ggcaacgcagacggcaagccctgcgtgttcccgttcaccttcgagggccgctcctactct
gcctgcaccacggacggccgctcagatggcaaccgctggtgcgccaccactgccagctac
gatcaggacaagctctatggcttctgcccgacccgagctgactcgacggtgaccgggggc
aactcggcgggggagcaatgcgtcttccccttcgtcttcctgggcaaggagtactcaagt
tgtaccagagagggccgcgacgatgggcgactctggtgtgccaccacctcgaacttcgac
agcgacaagaagtggggcttctgcccggatcaaggatacagcctgttccttgtggctgcc
cacgagtttggccacgctctgggcttagatcactccactgtgccggaggcgcttatgttc
cccatgtacagctacaccgagaagccccccctgcatgaggacgacgtgcaaggcatccag
catctgtatggttctggccctaaacctgaaccgcggcctccaaccaccgcaccggaaacg
cagcccaccgctcccccaacggtctgcattaccggacctcccactgcccgcccctcagag
agccctactactggccccacaggccctccttcaactggccccacgggtccccccactgct
agcccttctgccgcagctacagcgtctttaaatccagaggaggatgtctgcaacgtgaac
atcttcgacgccatcgcagagattgggaatcacttgcatttcttcaaggatgggaagtac
tggcgattctctgaggaccaggaacgcaaggtgcagggccccttccttatcagaaacacg
tggcctgcgctgccttccaagctggactccgcctttgaggagccgctcaccaagaagatt
ttctttttctctgggcgccaagtgtgggtttacactggaacgtcagtgctaggcccgagg
cgtctggacaagctgggctttggcccggaagtgacccaaatcactggggccctctcgcat
ggcgagggtaagatgctgctgttcagcaggcagaacttctggagattcgacgtgaagacg
cagatggtggatcccaagagtgccagccctgtggaccagatgttccctggggtgcccttg
gacatgcacgacatcttccagtaccgagagaaagcttacttctgccaggaccgcttctac
tggcgcatgagtttccagaatgaggtgggccaggtggatgaagtgggctacgtgactttc
gacctcctacagtgctctgaggcctaa

DBGET integrated database retrieval system