KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499675
Entry
107499675         CDS       T06036                                 

Gene name
PLCZ1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
  KO
K05861  phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00562  Inositol phosphate metabolism
ray01100  Metabolic pathways
ray04020  Calcium signaling pathway
ray04070  Phosphatidylinositol signaling system
ray04114  Oocyte meiosis
ray04919  Thyroid hormone signaling pathway
Module
ray_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107499675 (PLCZ1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107499675 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    107499675 (PLCZ1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107499675 (PLCZ1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107499675 (PLCZ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107499675 (PLCZ1)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     107499675 (PLCZ1)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    107499675 (PLCZ1)
SSDB
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like C2 DUF2972 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 107499675
NCBI-ProteinID: XP_015979598
LinkDB
Position
Unknown
AA seq 646 aa
MRISLTPFFVLHTWFLSMIRDDFKGGKINLEKTYKLLEKLNVQCSYIHVKYIFKDNDRLR
QGRITIEEFRSIYRIIAHREEILEIFNTYSENRKVLFEKNLVDFLTQEQYMLNTSKSFAS
EIIQKYEPIEEVKEARQMSVEGFIRYLCSSDCQLFENEYEKVYQDMTHPLNDYFISSSHN
TYLISDQLVGPSDIWGYVSALVKGCRCLEIDCWDGSQNEPVVYHGYTLTSKLLFKTVIQA
IHKYAFIASDYPLVLSLENHCSPPQQEVMADNLQFILGDSLLSDMLDDFSDQLPSPEALK
FKILVRNKKIGTLVETRERRNSDKHGQVQEYEEYEEADKEEEENKVKESETLAYLKGYPE
KETESKNLVRLPLFRKKRVKVALALSDLVIYTKAEKFRSFYYSKLYQQFNETNSIGESEA
RKLSKFSANDFILHTRKFVTRIYPRATRADSSNFNPQEFWNVGCQMVALNFQTPGLPMDL
QNGKFLDNGSSGYILKPQFLRDFETEFNPYEIPQNSNPVTLTIRLISGVQLPPSSHSSSN
KADTLVIIEIFGVPYDQMKQQTRVIRRNAFSPRWNETFTFVIQVPELALIRFVVENQNFL
TGNEFLGQYTLPVLCMSKGYRHVPLFSKFGQSLEPASLFTYIWYVR
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgagaatttccttaactcctttttttgtgcttcatacatggtttttgtcgatgattcgg
gatgactttaaaggtggcaaaattaatctagaaaaaacttataaattacttgaaaaatta
aatgttcaatgcagttatattcacgtgaaatatatatttaaggataatgacaggctgagg
caaggaagaatcaccatagaagaatttagatcaatttatcgaattattgcacacagagaa
gaaatacttgagattttcaacacgtattctgaaaaccggaaagttctttttgaaaaaaat
ctggttgattttttgacacaagaacagtacatgcttaacacaagtaaaagttttgcttct
gagatcattcaaaaatatgagcctattgaagaagttaaggaagcacgccagatgtcagta
gaaggttttataagatacctgtgttcatctgactgtcaactgtttgaaaatgagtatgaa
aaagtttatcaagatatgacccatccattaaatgattattttatttcaagttcacataat
acatacttgatatcagaccaattagtgggaccaagtgacatttggggatatgtaagtgct
cttgtgaaaggatgccgttgtctggaaattgattgctgggatggatcacaaaatgaacct
gttgtataccacggttatacactcaccagcaagcttctgtttaaaactgttatccaagca
atacacaaatatgcatttatagcatccgattacccactggtactctctttggagaatcac
tgctcccctccccaacaagaagtgatggcagacaatttgcagtttattttgggagattcc
ttgctttctgatatgcttgacgacttttcagaccaactaccttcaccagaggcattaaaa
ttcaaaatactagttagaaacaagaaaataggaaccttagtggaaacccgtgaaaggaga
aattctgataagcatggtcaggtacaggaatatgaagaatatgaagaggcagataaagaa
gaggaagagaacaaagtcaaagaatcagaaacattggcttatttaaaaggctatccagaa
aaggaaacagagtcaaaaaatttagttagattgccacttttcaggaaaaagagggtaaaa
gtggctctggccctatctgatcttgtcatttatactaaagctgagaagtttagaagcttt
tactattcaaaactctatcaacaatttaatgaaactaattctattggagagtcagaagct
cgaaaactttcaaaattttcagccaatgattttattcttcacaccaggaagttcgttacc
agaatatatcccagagcaacaagagcagactcttctaattttaatcctcaagaattttgg
aatgtaggttgtcaaatggtggctttaaatttccagacccctggtctgcctatggacctt
caaaatgggaaatttttggataatggtagttctggatatattttgaaaccacaatttcta
agagattttgaaacagagtttaatccatatgaaataccacaaaacagtaatccagttaca
cttacgataaggctcatcagtggtgtccagttgcctcccagtagtcattcatcatctaac
aaagctgacacattagtgattatagaaattttcggtgttccatatgatcaaatgaaacag
cagacccgtgtaattagaagaaatgcttttagtccaagatggaatgaaacattcacattt
gttattcaggtgccagaattggcattgatacgttttgttgtggaaaatcaaaatttttta
acaggaaatgaatttcttgggcaatatactttaccagtactatgcatgagcaaaggttac
cgccatgttcctctgttttccaaatttggtcagagtcttgagcctgcttcactatttact
tatatttggtatgtcagatag

DBGET integrated database retrieval system