KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499745
Entry
107499745         CDS       T06036                                 

Gene name
ADRBK2
Definition
(RefSeq) beta-adrenergic receptor kinase 2 isoform X1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray04340  Hedgehog signaling pathway
ray04724  Glutamatergic synapse
ray04740  Olfactory transduction
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107499745 (ADRBK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107499745 (ADRBK2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107499745 (ADRBK2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107499745 (ADRBK2)
  09157 Sensory system
   04740 Olfactory transduction
    107499745 (ADRBK2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107499745 (ADRBK2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     107499745 (ADRBK2)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   107499745 (ADRBK2)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107499745 (ADRBK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal HTH_WhiA
Other DBs
NCBI-GeneID: 107499745
NCBI-ProteinID: XP_015979700
LinkDB
Position
Unknown
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLEERNEITFDKIFS
QKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDTYIMKELLSC
SHPFSKQAVEHVQSHLAKKQVTSTLFQPYIEEICESLRGNIFQKFMESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHSRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPEVFSPE
LKSLLEGLLQRDVSKRLGCRGGGAQEVKAHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVAETVYEAVNADTDKIEARK
RAKNKQLGHEEDYALGKDCIMHGFMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQILSVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTETFTEAQRLLRR
APKFLNKSRSGVVELSKPPLCHRNSNGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctagaggccgtgctggccgatgtcagctacctgatggcgatggagaagagc
aaggcgaccccggccgcccgcgccagcaagaggatcgtcctgccggagcccagtatccgg
agtgtgatgcagaaatatcttgaggagaggaatgaaataacttttgacaagattttcagt
cagaaaattggtttcttgctatttaaagatttttgtttgaatgaaattaatgaagctgta
cctcaggtgaagttttatgaagagataaaagaatatgaaaagcttgataatgaggaagat
cgcctttgtagaagtcgacaaatttatgatacctacatcatgaaggagctgctgtcttgt
tcacatccattctcaaagcaagccgtagaacatgtacaaagtcatctagccaagaaacag
gtgacatcaactctttttcagccatacatagaagaaatttgtgaaagtcttcgaggcaac
atttttcaaaaatttatggaaagtgacaagttcactagattttgtcagtggaaaaatgta
gaattaaatatccatttgaccatgaatgatttcagcgtacataggatcattggacgaggc
ggctttggtgaagtatatggttgcaggaaagcagacactggaaaaatgtatgcaatgaaa
tgcttagataagaagaggatcaaaatgaaacaaggggaaactttagccttaaatgaaagg
attatgttgtcgctcgtgagtacaggagattgtcctttcattgtctgtatgacctatgcc
tttcatactccagataaactctgcttcattttggatctgatgaatgggggcgatttgcac
tatcacctttcacaacacggggtgttctctgagaaggagatgcggttctacgccaccgaa
atcatcctggggctggaacacatgcacagtcggtttgttgtttacagagatttgaagcct
gcaaatattctcctggatgaacatggacacgttaggatatcagatcttggtcttgcctgt
gatttttccaaaaagaagccacatgcaagtgttggcacccatgggtacatggctcccgaa
gtgctgcagaaggggacagcatatgacagcagtgccgactggttctccctgggctgcatg
cttttcaaactcctgagaggtcacagccctttccgacaacataaaaccaaagataagcat
gaaatagaccggatgacactcaccgtgaatgtggaacttccagaagtcttctcccctgaa
ctcaagtcccttctggagggcttgctgcagcgagacgttagcaagcggcttggctgtcgt
ggaggcggtgcacaggaagtgaaagcacacagctttttcaaaggcgtggactggcagcat
gtctacttacaaaagtatcctccacccttgattcctccccggggagaagtcaacgctgct
gatgcctttgacattggttcatttgatgaagaggacaccaaaggcatcaagcttcttgat
tgcgaccaagaactctacaagaacttccctttggtaatctctgaacgctggcagcaggaa
gtcgcggaaaccgtttatgaagcagtaaacgcagacacggataaaatcgaggccaggaag
agagctaaaaataagcaacttggccatgaagaagattacgctctgggaaaagactgtatt
atgcatgggttcatgctgaaactgggaaacccgtttctgactcagtggcagcgtcgatat
ttttacctttttccaaacagacttgaatggagaggagagggagagtcacgacaaaattta
ctaacgatggagcagattctgtctgtggaagaaactcagattaaagacaaaaaatgcatt
ttgttgagaataaaaggagggaagcagtttgtcttgcaatgtgagagtgatccagagttt
gtgcagtggaagaaagagttgacggaaacatttacagaggcccagcggttattgcgacgc
gctccaaagttcctcaacaagtctcgatcgggtgttgttgagctctcaaagccacccctc
tgtcacaggaatagcaatggcctctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503771
Entry
107503771         CDS       T06036                                 

Gene name
ADRBK1
Definition
(RefSeq) beta-adrenergic receptor kinase 1 isoform X1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray04340  Hedgehog signaling pathway
ray04724  Glutamatergic synapse
ray04740  Olfactory transduction
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107503771 (ADRBK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107503771 (ADRBK1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107503771 (ADRBK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107503771 (ADRBK1)
  09157 Sensory system
   04740 Olfactory transduction
    107503771 (ADRBK1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107503771 (ADRBK1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     107503771 (ADRBK1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   107503771 (ADRBK1)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107503771 (ADRBK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal DUF5647
Other DBs
NCBI-GeneID: 107503771
NCBI-ProteinID: XP_015988004
LinkDB
Position
Unknown
AA seq 689 aa
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLKHLEEARPLVEFYEEIKKYEKLETEEERLACSREIFDTYIMKELLAC
SHPFSKSATEHVQGHLAKRQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVSRRLGCLGRGAQEVKESPFFHSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLETRK
KTKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKARSPVVELSKVPLVQRGSANGL
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggcggacctggaggcggtgctggccgacgtgagctacctgatggccatggagaagagc
aaggccacgccggccgcgcgcgccagcaagaagatcctgctgcccgagcccagcatccgc
agtgtcatgcagaagtacctggaggaccggggtgaggtgacctttgagaagatcttctcg
cagaagctggggtacttgctcttccgagacttctgcctgaaacacctggaggaggccagg
cctttggtggagttctatgaggagatcaagaaatatgagaagctggagacggaggaggag
cgcctggcctgcagccgggagatcttcgacacctacatcatgaaggagctgctggcctgc
tcgcaccccttctcgaaaagtgccaccgagcatgtccagggccacctggcgaagaggcag
gtgcctccggatctcttccagccatacatcgaagagatttgtcagaacctccgaggggac
gtgttccagaaattcatcgagagtgataaattcacacgattttgccagtggaagaatgtg
gagctcaacatccacctgaccatgaacgacttcagcgtgcaccgcatcatcgggcgaggg
ggcttcggcgaggtgtatgggtgccggaaggccgacacgggcaagatgtacgccatgaag
tgtctggacaagaagcgcatcaagatgaagcagggagagaccctggccctcaacgagcgc
atcatgctgtctctcgtcagcaccggggactgcccgttcatcgtctgcatgtcgtacgcc
ttccacacgccagacaagctcagcttcatcctcgatctcatgaacggcggggacctgcac
taccacctgtcccagcacggggtcttttccgaagccgacatgcgcttctacgcagccgag
atcatcctgggcctggagcacatgcacaaccgcttcgtcgtctacagggacctgaagccg
gccaacatcctcctggacgagcatggccacgtgcgcatctcagacctgggcctggcctgc
gacttctccaagaagaagccccacgccagcgtgggcacccatgggtacatggcccctgaa
gttctgcagaagggtgtggcctatgacagcagcgccgactggttctccctgggctgcatg
ctcttcaagctgctgcgggggcacagccccttccggcagcacaagaccaaagacaagcat
gagatcgaccgcatgacgttgacaatggccgtggagctgcccgactccttctcccccgag
ctccgttccttactggaggggctgctgcagagggatgtcagccggagactgggctgcttg
ggccgaggggcccaggaggtgaaagagagccccttcttccactccctggactggcagatg
gtcttcttgcagaagtaccctcccccgctgatccccccacgaggggaggtgaacgccgcc
gatgccttcgacattggctcctttgacgaggaggacacaaaaggaatcaagttactggac
agcgaccaggagctctaccgcaacttccccctcaccatctccgagcggtggcagcaggag
gtggcagagaccgtcttcgataccatcaatgctgagaccgaccgactagagacccgcaag
aaaaccaaaaacaagcagctgggccatgaggaagactacgccctgggcaaggactgcatc
atgcacggctacatgtccaagatgggcaaccccttcctgacccagtggcagcggcggtac
ttctacctgttccccaaccggctcgagtggcggggcgagggcgaggccccgcagagcttg
ctgaccatggaggagatccagtcggtggaggagacacagatcaaggagcgaaagtgcctc
ctcctgaagatccgcggcggtaaacagttcgtccttcagtgcgacagcgacccggagctg
gtgcagtggaagaaggagctgcgcgacgcctaccgcgaggcccagcagctggtgcagcgg
gtgcccaagatgaagaacaaggcgcgctcgcccgtggtggagctgagcaaggtgccgctg
gtccagcgcggcagcgccaacggcctctga

DBGET integrated database retrieval system