KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499745
Entry
107499745         CDS       T06036                                 

Gene name
ADRBK2
Definition
(RefSeq) beta-adrenergic receptor kinase 2 isoform X1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray04340  Hedgehog signaling pathway
ray04724  Glutamatergic synapse
ray04740  Olfactory transduction
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107499745 (ADRBK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107499745 (ADRBK2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107499745 (ADRBK2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107499745 (ADRBK2)
  09157 Sensory system
   04740 Olfactory transduction
    107499745 (ADRBK2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107499745 (ADRBK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107499745 (ADRBK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107499745 (ADRBK2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     107499745 (ADRBK2)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   107499745 (ADRBK2)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107499745 (ADRBK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal HTH_WhiA
Other DBs
NCBI-GeneID: 107499745
NCBI-ProteinID: XP_015979700
LinkDB
Position
Unknown
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLEERNEITFDKIFS
QKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDTYIMKELLSC
SHPFSKQAVEHVQSHLAKKQVTSTLFQPYIEEICESLRGNIFQKFMESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHSRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPEVFSPE
LKSLLEGLLQRDVSKRLGCRGGGAQEVKAHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVAETVYEAVNADTDKIEARK
RAKNKQLGHEEDYALGKDCIMHGFMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQILSVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTETFTEAQRLLRR
APKFLNKSRSGVVELSKPPLCHRNSNGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctagaggccgtgctggccgatgtcagctacctgatggcgatggagaagagc
aaggcgaccccggccgcccgcgccagcaagaggatcgtcctgccggagcccagtatccgg
agtgtgatgcagaaatatcttgaggagaggaatgaaataacttttgacaagattttcagt
cagaaaattggtttcttgctatttaaagatttttgtttgaatgaaattaatgaagctgta
cctcaggtgaagttttatgaagagataaaagaatatgaaaagcttgataatgaggaagat
cgcctttgtagaagtcgacaaatttatgatacctacatcatgaaggagctgctgtcttgt
tcacatccattctcaaagcaagccgtagaacatgtacaaagtcatctagccaagaaacag
gtgacatcaactctttttcagccatacatagaagaaatttgtgaaagtcttcgaggcaac
atttttcaaaaatttatggaaagtgacaagttcactagattttgtcagtggaaaaatgta
gaattaaatatccatttgaccatgaatgatttcagcgtacataggatcattggacgaggc
ggctttggtgaagtatatggttgcaggaaagcagacactggaaaaatgtatgcaatgaaa
tgcttagataagaagaggatcaaaatgaaacaaggggaaactttagccttaaatgaaagg
attatgttgtcgctcgtgagtacaggagattgtcctttcattgtctgtatgacctatgcc
tttcatactccagataaactctgcttcattttggatctgatgaatgggggcgatttgcac
tatcacctttcacaacacggggtgttctctgagaaggagatgcggttctacgccaccgaa
atcatcctggggctggaacacatgcacagtcggtttgttgtttacagagatttgaagcct
gcaaatattctcctggatgaacatggacacgttaggatatcagatcttggtcttgcctgt
gatttttccaaaaagaagccacatgcaagtgttggcacccatgggtacatggctcccgaa
gtgctgcagaaggggacagcatatgacagcagtgccgactggttctccctgggctgcatg
cttttcaaactcctgagaggtcacagccctttccgacaacataaaaccaaagataagcat
gaaatagaccggatgacactcaccgtgaatgtggaacttccagaagtcttctcccctgaa
ctcaagtcccttctggagggcttgctgcagcgagacgttagcaagcggcttggctgtcgt
ggaggcggtgcacaggaagtgaaagcacacagctttttcaaaggcgtggactggcagcat
gtctacttacaaaagtatcctccacccttgattcctccccggggagaagtcaacgctgct
gatgcctttgacattggttcatttgatgaagaggacaccaaaggcatcaagcttcttgat
tgcgaccaagaactctacaagaacttccctttggtaatctctgaacgctggcagcaggaa
gtcgcggaaaccgtttatgaagcagtaaacgcagacacggataaaatcgaggccaggaag
agagctaaaaataagcaacttggccatgaagaagattacgctctgggaaaagactgtatt
atgcatgggttcatgctgaaactgggaaacccgtttctgactcagtggcagcgtcgatat
ttttacctttttccaaacagacttgaatggagaggagagggagagtcacgacaaaattta
ctaacgatggagcagattctgtctgtggaagaaactcagattaaagacaaaaaatgcatt
ttgttgagaataaaaggagggaagcagtttgtcttgcaatgtgagagtgatccagagttt
gtgcagtggaagaaagagttgacggaaacatttacagaggcccagcggttattgcgacgc
gctccaaagttcctcaacaagtctcgatcgggtgttgttgagctctcaaagccacccctc
tgtcacaggaatagcaatggcctctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503771
Entry
107503771         CDS       T06036                                 

Gene name
ADRBK1
Definition
(RefSeq) beta-adrenergic receptor kinase 1 isoform X1
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray04340  Hedgehog signaling pathway
ray04724  Glutamatergic synapse
ray04740  Olfactory transduction
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107503771 (ADRBK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107503771 (ADRBK1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107503771 (ADRBK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    107503771 (ADRBK1)
  09157 Sensory system
   04740 Olfactory transduction
    107503771 (ADRBK1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107503771 (ADRBK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107503771 (ADRBK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107503771 (ADRBK1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     107503771 (ADRBK1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   107503771 (ADRBK1)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107503771 (ADRBK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal DUF5647
Other DBs
NCBI-GeneID: 107503771
NCBI-ProteinID: XP_015988004
LinkDB
Position
Unknown
AA seq 689 aa
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLKHLEEARPLVEFYEEIKKYEKLETEEERLACSREIFDTYIMKELLAC
SHPFSKSATEHVQGHLAKRQVPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVSRRLGCLGRGAQEVKESPFFHSLDWQMVFLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLETRK
KTKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSL
LTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDPELVQWKKELRDAYREAQQLVQR
VPKMKNKARSPVVELSKVPLVQRGSANGL
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggcggacctggaggcggtgctggccgacgtgagctacctgatggccatggagaagagc
aaggccacgccggccgcgcgcgccagcaagaagatcctgctgcccgagcccagcatccgc
agtgtcatgcagaagtacctggaggaccggggtgaggtgacctttgagaagatcttctcg
cagaagctggggtacttgctcttccgagacttctgcctgaaacacctggaggaggccagg
cctttggtggagttctatgaggagatcaagaaatatgagaagctggagacggaggaggag
cgcctggcctgcagccgggagatcttcgacacctacatcatgaaggagctgctggcctgc
tcgcaccccttctcgaaaagtgccaccgagcatgtccagggccacctggcgaagaggcag
gtgcctccggatctcttccagccatacatcgaagagatttgtcagaacctccgaggggac
gtgttccagaaattcatcgagagtgataaattcacacgattttgccagtggaagaatgtg
gagctcaacatccacctgaccatgaacgacttcagcgtgcaccgcatcatcgggcgaggg
ggcttcggcgaggtgtatgggtgccggaaggccgacacgggcaagatgtacgccatgaag
tgtctggacaagaagcgcatcaagatgaagcagggagagaccctggccctcaacgagcgc
atcatgctgtctctcgtcagcaccggggactgcccgttcatcgtctgcatgtcgtacgcc
ttccacacgccagacaagctcagcttcatcctcgatctcatgaacggcggggacctgcac
taccacctgtcccagcacggggtcttttccgaagccgacatgcgcttctacgcagccgag
atcatcctgggcctggagcacatgcacaaccgcttcgtcgtctacagggacctgaagccg
gccaacatcctcctggacgagcatggccacgtgcgcatctcagacctgggcctggcctgc
gacttctccaagaagaagccccacgccagcgtgggcacccatgggtacatggcccctgaa
gttctgcagaagggtgtggcctatgacagcagcgccgactggttctccctgggctgcatg
ctcttcaagctgctgcgggggcacagccccttccggcagcacaagaccaaagacaagcat
gagatcgaccgcatgacgttgacaatggccgtggagctgcccgactccttctcccccgag
ctccgttccttactggaggggctgctgcagagggatgtcagccggagactgggctgcttg
ggccgaggggcccaggaggtgaaagagagccccttcttccactccctggactggcagatg
gtcttcttgcagaagtaccctcccccgctgatccccccacgaggggaggtgaacgccgcc
gatgccttcgacattggctcctttgacgaggaggacacaaaaggaatcaagttactggac
agcgaccaggagctctaccgcaacttccccctcaccatctccgagcggtggcagcaggag
gtggcagagaccgtcttcgataccatcaatgctgagaccgaccgactagagacccgcaag
aaaaccaaaaacaagcagctgggccatgaggaagactacgccctgggcaaggactgcatc
atgcacggctacatgtccaagatgggcaaccccttcctgacccagtggcagcggcggtac
ttctacctgttccccaaccggctcgagtggcggggcgagggcgaggccccgcagagcttg
ctgaccatggaggagatccagtcggtggaggagacacagatcaaggagcgaaagtgcctc
ctcctgaagatccgcggcggtaaacagttcgtccttcagtgcgacagcgacccggagctg
gtgcagtggaagaaggagctgcgcgacgcctaccgcgaggcccagcagctggtgcagcgg
gtgcccaagatgaagaacaaggcgcgctcgcccgtggtggagctgagcaaggtgccgctg
gtccagcgcggcagcgccaacggcctctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509393
Entry
107509393         CDS       T06036                                 

Gene name
GRK7
Definition
(RefSeq) G protein-coupled receptor kinase 7
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107509393 (GRK7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107509393 (GRK7)
  09157 Sensory system
   04744 Phototransduction
    107509393 (GRK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107509393 (GRK7)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     107509393 (GRK7)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   107509393 (GRK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 107509393
NCBI-ProteinID: XP_015997337
LinkDB
Position
Unknown
AA seq 552 aa
MVDMGGLDNLIANTAYLQARKTSDGDSRELQRRRRSLALPGPQRCAQLRQDLPADFDSLC
EQQPIGRRLFRDFLATVAPYQEAVAFLEEVQSWELAEEGPAKSSTLQGLVAACAAAPAQG
NPYPFLSPALATKCQAATTEEERAALVGLAKAEAMAFLQDQPFRDFLASPFYDKFLQWKV
FEMQPVSDKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKNGEKMALSEK
EILERISSPFIVSLAYAFESKTHLCLVMSLMNGGDLKFHIYSVGTRGLAMSRVVFYSAQM
TCAVLHLHSLGIVYRDLKPENVLLDDQGNCRLSDLGLAVQIQDGKPVTQRAGTNGYMAPE
ILMEKASYSYPVDWFAMGCSIYEMIAGRTPFKDYKEKVSKEDLKQRTLKEEVRFQHDNFT
EEAKDICRLFLAKKPEQRLGSRKKSDDPRKHPFFKTINFTRLEAGLIEPPFVPDPSVVYA
KDIDEIEDFSEVRGVEFDDKDQKFFQRFATGAVPIAWQEEIIETGLFEELNDPNRPAGGE
GNSSKSGVCLLL
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggtggacatgggcggcctggacaacttgatcgccaacacagcctacctgcaggcccgg
aagacctctgacggagacagcagggagctgcagcggaggcgccgcagcctggcgctgccc
gggccacagcgctgcgcccagctccgccaggacctgcccgcggacttcgacagcctgtgc
gagcagcagcccatcggccgccgccttttccgggactttctagccacagtggccccgtac
caagaggcagtggccttccttgaggaggtgcagagctgggagctagccgaggagggcccc
gccaagagcagcacgttgcagggactggtggccgcttgtgcggctgctcctgcccagggg
aacccataccctttcctcagcccagctttggccaccaagtgccaagcagccaccactgag
gaagagagagcggcccttgtcggactggccaaagctgaggccatggccttcttgcaggac
cagcctttccgggatttcctggccagccccttctatgacaagtttctgcagtggaaagtc
tttgagatgcaaccggtgtcagacaagtacttcactgagttccgggtgctgggaaaaggt
ggttttggggaggtatgtgccgtccaggtgaaaaacactggcaagatgtatgcctgcaag
aaactggacaagaagcggctgaagaagaaaaacggtgagaaaatggctctctcggaaaag
gaaatcttggagcggatcagcagccctttcatcgtctctctggcctatgcctttgagagc
aagacccacctctgcctagtcatgagcctgatgaatgggggagacctcaagttccacatc
tacagcgtgggcacgcggggcctagccatgagcagggtggtcttctactcggcccagatg
acctgcgcggtgctgcacctgcactcccttggcatcgtctaccgggacctgaagcctgag
aacgtgcttctagacgaccaaggcaactgcaggctgtccgacctggggttggctgtgcag
atccaagatggcaagcctgtcacccagagggctggaacgaatggttatatggctcctgaa
atcctaatggaaaaagcaagttattcctatcctgtggactggtttgcaatgggatgcagt
atttatgaaatgattgctgggagaacaccattcaaagattacaaagaaaaagtcagtaaa
gaggatttaaagcaaagaactctgaaagaagaggtcagattccaacatgataacttcaca
gaggaagcaaaagatatttgcagactcttcttggctaaaaagccagagcagcgcttagga
agcagaaaaaagtctgatgatcccaggaaacatcctttcttcaaaaccatcaactttact
cgcctggaagccggcctaattgaacccccatttgtgccagacccttcggtggtatatgcc
aaagacatcgatgaaattgaagatttctctgaggtccggggggttgaatttgatgataaa
gatcagaagttcttccaaagatttgcaacaggtgctgtccccatagcatggcaggaggag
attatagaaacgggactgtttgaagaattgaatgaccccaacaggcctgcaggtggagag
ggtaattcatccaagtctggtgtgtgtttgttattataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509758
Entry
107509758         CDS       T06036                                 

Gene name
GRK5
Definition
(RefSeq) G protein-coupled receptor kinase 5 isoform X1
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107509758 (GRK5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107509758 (GRK5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107509758 (GRK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107509758 (GRK5)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     107509758 (GRK5)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   107509758 (GRK5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Pkinase_fungal Kinase-like Sulfakinin
Other DBs
NCBI-GeneID: 107509758
NCBI-ProteinID: XP_015998017
LinkDB
Position
Unknown
AA seq 590 aa
MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTVDRDYCSLCDKQ
PIGRLLFRQFCETRPGLECYIQFLDSVAEYEVTPDEKLGEKGKEVMTKYLTPKSPGFIAQ
VGQDLVSQAEEKLLQRPCKELFSACAQSVHNYLSGEPFHKYLDSMYFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVSACQVRATGKMYACKRLEKKRIKKRKGESMALNEKRILEK
VSSRFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGELIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLLYEMVEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKSIC
KMLLTKDAKQRLGCQDEGAAEVKRHPFFRSMNFKRLEAGMLDPPFIPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEMIETECFKELNVFGPNGTLPPDLNRS
HPPEPPKKGLLQRIFQRQHQNNSKSSPNSKASFNHHINSNHVNSNSTGSS
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggagctggaaaacatcgtggccaacacggtcttgttgaaagccagggaagggggcgga
ggaaagcgcaaagggaagagcaagaagtggaaggaaatcctgaagttccctcacatcagc
cagtgtgaagatctccggaggactgtagacagagattactgcagtttatgtgacaagcag
cccattgggaggctgcttttccggcagttctgtgaaacaagacctgggctggagtgttac
atccagttcttggactcagtggcagaatatgaagttactccagatgaaaaactgggagaa
aaagggaaggaagttatgaccaagtacctcaccccaaagtccccaggtttcatcgcccaa
gttggccaggacctggtctcgcaggcagaggagaagctccttcagaggccgtgcaaagaa
ctcttctccgcctgtgcacagtctgtccacaactacctgagtggagagcccttccacaag
tatctggacagcatgtattttgatcgctttctccagtggaagtggttggaaaggcaacca
gtgaccaaaaacacgttcaggcagtaccgagtgctaggaaaagggggcttcggggaggtg
agtgcctgccaggtgcgggccacgggaaagatgtacgcctgcaagcgcctggagaagaag
aggatcaagaagcggaagggggagtccatggccctcaacgagaagcgcatcctggagaag
gtcagcagccggttcgtggtcaacctggcctacgcctatgagaccaaggacgcgttgtgc
ttggttctgaccatcatgaacgggggtgacctgaagttccacatctacaacatggggaac
cccggcttcgaggaggagcgagccttgttctacgcggcagagatcctgtgcggcttggaa
gacctgcatcgtgagaacacggtgtacagagatctgaaacccgaaaatatcctgttagac
gattacggtcacatcaggatctcagacctgggcctggccgtgaagatccccgagggagag
ctgatccgcggccgggtgggcaccgtcggctacatggccccagaggtcctgaacaaccag
aggtacggcctgagccccgactactggggtctgggctgcctcctctatgagatggtcgag
ggccagtcgccgttccgaggccgcaaggagaaggtgaaacgggaggaggtggaccgccgg
gtcctggagaccgaggaggtgtactcccacaagttctccgaggaggccaagtccatctgc
aaaatgctgctcaccaaagacgcgaagcagaggctgggctgccaggacgagggggccgca
gaggtcaagaggcaccccttcttcaggagcatgaatttcaaacgcctggaagccgggatg
ctggacccgcccttcattcccgacccccgggccgtgtactgtaaggacgtgctggacatc
gagcagttctccaccgtgaagggcgtcaacctggaccacacggacgacgacttctactcc
aagttctccaccggctccgtgcccatcccgtggcagaacgagatgatagaaacagaatgc
tttaaagagctgaacgtgtttggacctaacggtaccctcccgccagacctgaacagaagt
caccctccagaaccgccgaagaaagggctgctccagagaatcttccagcgtcagcatcag
aacaattccaagagttcgcccaattccaaggccagttttaaccaccacataaattcaaac
catgtcaattccaactccaccggaagcagctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514359
Entry
107514359         CDS       T06036                                 

Gene name
GRK1
Definition
(RefSeq) rhodopsin kinase
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107514359 (GRK1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107514359 (GRK1)
  09157 Sensory system
   04744 Phototransduction
    107514359 (GRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107514359 (GRK1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     107514359 (GRK1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   107514359 (GRK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 107514359
NCBI-ProteinID: XP_016007457
LinkDB
Position
Unknown
AA seq 564 aa
MDFGSLETVVANSAFIAARGSFDGSSAPSSRDKKYLAKLKLPPLSKCESLRDGLNLEFQS
LCSEQPIGKRLFQQFLKADERHVPALELWKDIEDYDTADDDLRPQKAQAILAEYLDPQAK
LFCSFLDEGMVVKVREGVVASGDGLFQPLLQATLAYLSQAPFQEYLDTLYFQRFLQWKWL
EAQPTGEDWFLDFRVLGKGGFGEVSACQMKATGKMYACKKLNKKRLKKRKGYQGAMVEKK
ILAKVHSRFIVSLAYAFETKTDLCLVMTIMNGGDLRYHIYNVDEENPGFQEPRAIFYTAQ
IISGLEHLHQRAIVYRDLKPENVLLDNDGNVRISDLGLAVELKEGQTKTKGYAGTPGFMA
PELLRGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRILSEPVKYLDKFS
QASKDFCEALLEKDPEKRLGFRDGTCDRLRANTLFKDINWRQLEAGMLIPPFIPDSKTVY
AKNIQDVGAFSTVRGVVFDKADTEFFQEFATGNCSIPWQEEMIETGIFGDLNVWRADGQM
PDDMKGVTVNEAAPSSKSGMCLVS
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggatttcgggtccttggagacagtggtcgccaattctgccttcatcgccgcccggggc
agcttcgatgggagcagtgccccgtcctcccgggataagaagtacctggccaagctcaag
ctgcctcctctctccaaatgcgagagcctccgggacggcctgaacctggagttccagagt
ttgtgctcggagcagcccatcggcaagcggctcttccagcagttcctgaaggccgatgag
aggcacgtgccggccctggagctctggaaggacatcgaggattacgacacagccgatgac
gacctccggccgcagaaggcccaggccatcctggctgagtacctggaccctcaggccaaa
ctcttttgcagcttcctggatgaaggaatggtggtgaaggtccgggagggggttgtggca
agcggggacgggctcttccagcccctcctgcaggccaccctcgcctacctgagccaggcc
ccattccaagaatacctggacaccctgtacttccagaggttcctgcagtggaagtggctg
gaggcccagcccacaggagaggactggtttctggacttcagggtcctggggaaaggtggc
tttggggaggtgtcggcctgccagatgaaggcgactggcaagatgtatgcatgtaaaaag
cttaataagaagaggctgaagaagaggaaggggtaccagggtgctatggtagagaagaag
attctagcaaaagtacacagcaggtttatagtttctctggcctatgcgtttgaaaccaaa
actgacctctgtctggtgatgaccatcatgaatggaggcgacttaaggtaccacatctac
aacgtggatgaggagaatcccggcttccaggagcctcgcgccatcttctacacggcccag
atcatcagtggcctggagcacctgcaccagagggccatcgtctaccgagacctcaagcct
gagaacgtgctcctggacaacgacggcaatgttagaatttctgaccttggactggccgtg
gagctaaaggaagggcagaccaagaccaagggctatgcagggactccaggtttcatggcc
cccgagctcctgcggggcgaggagtacgatttttccgtggattactttgccctgggggtc
acgctatatgagatgattgcggccagaggacccttccgagcccggggagagaaggtggag
aacaaggaactcaagcagaggatcctctcagagccagtcaagtacctggacaagttcagc
caggccagcaaggacttctgtgaggcactgctggagaaggacccagagaagcgcctgggg
tttagagacgggacttgtgataggctccgtgccaacaccctctttaaagacattaactgg
agacagcttgaggctggaatgctgataccgccgttcatcccagactccaaaactgtctac
gcaaagaacatccaggacgtaggggccttttccacggtcagaggtgtggtcttcgacaaa
gcggatacagaattcttccaggaatttgccactggcaactgctccattccctggcaggag
gagatgattgagacaggcatctttggggacctgaatgtatggcgtgctgacgggcagatg
cccgatgacatgaagggggtcactgtgaatgaggctgctccctcgtccaagtcaggaatg
tgtctggtttcctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517532
Entry
107517532         CDS       T06036                                 

Gene name
GRK6
Definition
(RefSeq) G protein-coupled receptor kinase 6 isoform X1
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107517532 (GRK6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107517532 (GRK6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107517532 (GRK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107517532 (GRK6)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     107517532 (GRK6)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   107517532 (GRK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 107517532
NCBI-ProteinID: XP_016013818
LinkDB
Position
Unknown
AA seq 576 aa
MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLEHDYHSLCERQ
PIGRLLFREFCATRPELTRCTAFLDGVAEYEVTPDEKRKACGQRLMQNFLSHTGPDLIPE
VPRQLVTNCAQRLEQGPCKDLFQELTRLTHEYLSMAPFADYLDSIYFNRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLE
DLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNE
RYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVAEEYSDRFSPQARSLC
SQLLCKDPAERLGCCGGGAREVKEHPLFKKLNFKRLGAGMQEPPFKPDPQAIYCKDVLDI
EQFSTVKGVELEPTDQDFYQKFATGSVPIPWQNEMVETECFQELNVFGMDGSVPPDLDWK
GQPPAPPKKGLLQRLFSRQDCCGNCSDSEEELPTRL
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggagctcgagaacatcgtagcgaacacggtgctactcaaggcccgggaaggtggtggc
ggcaatcgcaaaggcaaaagcaagaaatggcgacagatgctgcagttcccccacatcagc
cagtgtgaagagcttcggctcagccttgaacatgactaccacagcctgtgtgagcggcag
cccatcgggcgcctgctgttccgagagttctgtgcgacaaggcctgagctgacccgctgc
actgccttcctggatggggtggctgagtatgaagtgacccctgatgagaagcggaaggca
tgtgggcagcggctaatgcagaatttcttgagccacacgggtcctgacctcatccctgaa
gtcccccggcaactggtgactaactgtgcccagcggctggagcaggggccctgcaaagac
ctcttccaggagctcacccggctgacccatgagtacctgagtatggccccctttgctgac
tacctcgacagcatctacttcaaccgtttcctgcagtggaagtggctggaaaggcagcca
gtgaccaaaaacaccttcaggcagtaccgagtcctgggcaaaggtggctttggggaggtg
tgcgcctgccaagtgcgggcaacaggcaagatgtatgcctgcaaaaagcttgagaagaaa
cgaatcaaaaagcggaaaggggaggccatggcactcaatgagaagcagatcctggagaaa
gtgaacagtaggtttgtagtgagcttggcctatgcctatgagaccaaggacgcgctatgc
ctggtgctgacgctaatgaatggaggtgacctcaagttccacatctaccacatgggtcag
gctggcttccctgaggcacgggccgtcttttatgctgcagagatttgctgtggcctggag
gacctgcaccgggagcgcatcgtgtacagggacctgaagccagagaacatcctactggat
gaccatggtcacatccgcatctccgacctggggctggctgtgcatgtgcccgagggccag
accatcaaaggccgtgtgggcaccgtgggctacatggctccagaggtggtgaagaacgaa
cggtacacattcagccccgactggtgggcgctaggctgcctcttatatgagatgatcgca
ggccagtcacccttccagcagaggaaaaagaagatcaagcgggaggaggtggagcggctg
gtaaaggaggtggctgaggagtactccgatcgcttttccccacaggcccgctcactctgc
tcccagctcctctgcaaggaccctgctgagcgtctgggttgttgtgggggtggtgcccgt
gaggtgaaggagcaccccctcttcaagaagctgaacttcaagcgtctgggagccggcatg
caggaaccacccttcaagcctgatccccaggccatttactgcaaggatgtcctggacatt
gaacagttctccacggttaagggcgtagagctggagcccaccgaccaggacttctaccag
aagtttgccacgggcagcgtacccatcccctggcagaacgagatggtggagaccgagtgc
ttccaggaactgaatgtcttcggcatggacggctcggttcccccagacctggactggaag
ggccagccccctgcaccccccaagaagggactgctgcagagactcttcagtcgccaggat
tgctgtgggaactgcagcgacagcgaggaagagctccccacccgcctctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517995
Entry
107517995         CDS       T06036                                 

Gene name
GRK4
Definition
(RefSeq) G protein-coupled receptor kinase 4 isoform X1
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04144  Endocytosis
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107517995 (GRK4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107517995 (GRK4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107517995 (GRK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107517995 (GRK4)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     107517995 (GRK4)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   107517995 (GRK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 107517995
NCBI-ProteinID: XP_016014732
LinkDB
Position
Unknown
AA seq 589 aa
MELENLLANSLLLKARQGGFGKKSGRSKKWREMLKLPSVNLCSELRHTIEKDYNSLCDKQ
PIGRLLFRQFCDTKHDLKRCIEFLDAVAEYEVAADEDRRDCGLLILDTFFSKESSVAPLP
VMPPHVVIECAVRLSKDPVKEVFAGCTRVVHSYLSGKPFEEYQESPYFSRFLQWKWLERY
VPTRSSMKTSRRPVTKKTFRHYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKG
EAMALNERKILEKVHSRFVVSLCYTYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQR
AVFYAAEVCCGLEDLQRERIVYRDLKPENILLDDHGHIRISDLGLAMEIPKGETIRGRVG
TVGYMAPEVINNENYTFSPDWWGLGCLIYEMIQGHSPFRKFKEKIRREEVERRVNTDTEE
YSEKFSADAKSICRMLLTKNPKQRLGCKGDGAAGVKQHPVFKDINFRRLEANMLEPPFCP
DPQAIYCKDILDIERFSTVKGVCLDTADSTFYGQFVTGCVSIPWQNEMIESECFKDINES
KSEESMALDLEDKTESVLRPKRGFIYRLLKIGGCIDPGASEKEQVPTQL
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggagctggaaaacctcctggccaactcgctgctgctgaaagcgcgccaaggaggattt
ggcaaaaaaagtggtcgtagtaaaaaatggagggagatgctgaagctgccttctgttaac
ctgtgcagcgagcttagacacaccattgaaaaggattataatagtctttgtgacaagcag
ccaataggaagacttctcttcaggcagttctgtgatacgaaacatgatctaaagaggtgc
attgaattcctggatgctgtggcagaatacgaagtggccgctgatgaagaccgaagagac
tgtggactgttaatcttagacacattcttcagtaaagagagctcggtggcccctttgcca
gtgatgcccccacacgtcgtgattgagtgtgcagtgcgactgagcaaggaccctgtcaag
gaggtcttcgcgggctgcaccagggttgtccatagctatctaagtggaaaaccatttgaa
gaataccaagaaagcccatatttttctcgatttttacagtggaagtggctggaaaggtat
gttccgactcgaagctcaatgaaaacaagtaggcgtccagtaacaaagaaaacatttaga
cattatagagttctaggaaaaggtgggtttggagaggtttgtgcctgtcaagtgagagct
acagggaaaatgtacgcctgtaaaaagctagaaaaaaagagaataaagaagaggaaaggc
gaagctatggctctaaatgaaagaaagatcctggagaaggtgcacagtagatttgtagtt
agtctatgctacacttacgaaaccaaagacgccctttgcttggtgctaaccattatgaat
ggaggggacttgaagttccacatttacaacctgggcaaccccggcttcgacgagcagaga
gccgtcttctatgccgccgaggtgtgctgtggcttggaggacttgcagcgggaaagaatt
gtgtacagagacttaaagcctgagaatattctcctcgatgatcatggacatatccggatt
tcagatcttggtttagccatggagatccccaaaggggagacgattcgaggaagagttgga
acagtcggctacatggctcctgaagttatcaataatgaaaactatacatttagtcctgac
tggtggggacttggctgtctgatatatgaaatgattcagggacattctccattcagaaaa
ttcaaagagaaaatcagacgggaggaggtggagcggcgcgtgaacaccgacacggaggag
tactccgagaagttttcggcggatgccaagtccatctgcaggatgttactcaccaagaat
cccaaacagcgcctgggctgcaagggtgacggagcagccggagtgaaacagcaccccgtg
ttcaaggacatcaacttcaggaggctggaggcaaacatgctagagcccccgttctgcccc
gacccacaagccatttattgtaaggacatcctggacatcgagcgcttctccacggtgaag
ggggtctgcctggacactgccgacagcaccttctacggccagtttgtcacgggctgcgtc
tccataccctggcagaacgagatgatcgaatccgaatgtttcaaggacatcaacgaaagt
aaaagtgaggaaagtatggcattagatctagaagacaaaacagaatcagttctcagacca
aagagaggcttcatctatagactcctcaaaatagggggctgcattgaccctggagccagt
gagaaggagcaggtgcccacacaactgtga

DBGET integrated database retrieval system