KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499773
Entry
107499773         CDS       T06036                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107499773 (WNT8B)
   04390 Hippo signaling pathway
    107499773 (WNT8B)
   04150 mTOR signaling pathway
    107499773 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107499773 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107499773 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107499773 (WNT8B)
   05205 Proteoglycans in cancer
    107499773 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107499773 (WNT8B)
   05226 Gastric cancer
    107499773 (WNT8B)
   05217 Basal cell carcinoma
    107499773 (WNT8B)
   05224 Breast cancer
    107499773 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107499773 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    107499773 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107499773 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107499773 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107499773 (WNT8B)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107499773 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107499773
NCBI-ProteinID: XP_015979746
LinkDB
Position
Unknown
AA seq 349 aa
MGSLFLLGASPLCSVVFLSSRSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAWDR
WNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQL
GGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKC
HGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSIS
TRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERR
AETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPARKP
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgggaagcttgttcctccttggcgcatctccgttatgctctgtggttttcctctcttct
aggtcagtgaacaatttcctgatgactggtccaaaggcttacctaatctactccagcagc
gtggcagctggtgcccagagtggtattgaagaatgcaaataccagtttgcctgggaccgc
tggaactgccccgagagagccctgcagctgtccagccatggcggccttcgcagtgctaat
cgggagacagcattcgtacatgccatcagttctgccggggtcatgtacactctgactaga
aactgcagccttggggattttgacaactgtggctgtgatgactcccgcaatggacaactg
ggagggcaaggctggctgtggggaggctgcagtgacaacgtgggcttcggagaggcaata
tccaagcagttcgtcgacgccctggagacaggacaggatgcccgggctgccatgaacctg
cacaacaacgaggccggccgcaaggcggtgaagggcaccatgaaacgcacgtgtaagtgc
cacggcgtgtctggcagctgcaccacgcagacttgctggttgcagctccccgagttccgt
gaggtgggtgcgcacctgaaggaaaagtatcacgcagctctcaaagtggacctgctgcaa
ggtgctggcaacagcgcggcgggccgcggcgccatcgccgacactttccgctccatctcc
actcgggagctggtgcacttggaggactccccggactactgcctggagaacaaaacgctg
ggactgctgggcaccgaaggccgagagtgcttgcgacgcgggcgggccctgggccgctgg
gagcgccgcagctgccgccggctctgcggggactgtgggctggcagtggaggagcgccgc
gccgagaccgtgtccagctgcaactgcaagttccactggtgctgcgccgtccgctgcgag
cagtgccgccggcgagtcaccaagtacttctgtagtcgtgcggagcggccacgtgggggc
gcggcacacaaacccgcgaggaaaccctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499803
Entry
107499803         CDS       T06036                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b isoform X1
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107499803 (WNT2B)
   04390 Hippo signaling pathway
    107499803 (WNT2B)
   04150 mTOR signaling pathway
    107499803 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107499803 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107499803 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107499803 (WNT2B)
   05205 Proteoglycans in cancer
    107499803 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107499803 (WNT2B)
   05226 Gastric cancer
    107499803 (WNT2B)
   05217 Basal cell carcinoma
    107499803 (WNT2B)
   05224 Breast cancer
    107499803 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107499803 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    107499803 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107499803 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107499803 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107499803 (WNT2B)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107499803 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107499803
NCBI-ProteinID: XP_015979803
LinkDB
Position
Unknown
AA seq 402 aa
MVGDHSITLSATAKLFLQNLWETVLPIRLRECGLRKGKGPYQGLMPNLSPSIPLLMQKKG
WDALTGPFPPCRYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQH
QFRHHRWNCTTVDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCD
PYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAV
RRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQ
GYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRV
TRVTQCECKFHWCCAVRCKECRNTVDIHTCKAPKKAEWLDQT
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggtgggagaccactcaattactctctctgcaactgcaaaactatttctccagaacttg
tgggaaacggtcctacccatcaggctcagggaatgtgggttaaggaaggggaagggacca
taccaaggtctaatgccaaacctctccccttccattcctctcctaatgcagaagaagggc
tgggatgctctgacagggccatttcctccttgcaggtacatcggggcgctgggggcccga
gtgatctgtgacaacatccctggtctggtgagccggcagcggcagctgtgccagcgttat
ccagacatcatgcgctcggtgggcgagggtgcccgagaatggatccgagagtgtcagcac
cagttccgccaccaccgctggaactgcaccaccgtggaccgggaccacactgtctttggc
cgtgtcatgctcagaagtagccgggaagcagcatttgtgtacgccatctcgtcagcaggg
gtggtccatgctattactcgcgcctgcagccagggcgaactgagtgtgtgcagctgtgac
ccctacacccgtggccgacaccatgaccaacgtggggactttgactggggtggctgcagt
gataatatccactatggtgttcgctttgccaaggcctttgtggatgccaaggagaagagg
cttaaggatgcccgagccctcatgaacttacataacaaccgctgtggtcgcacggctgtg
cggcggtttctgaagctggagtgtaagtgccatggcgtgagtggctcctgtactctgcgc
acctgctggcgtgcactctcagacttccgccgcacaggtgattacctgcggcggcgctat
gatggggctgtgcaggtgacggccacccaggatggcgctaacttcacagcagcccgccaa
ggctatcgccgtgccacccgaactgaccttgtctactttgacaactccccagactactgt
gtcttggacaaggctgcaggttccctcggaactgcaggccgtgtctgcagcaagacatct
aaagggacagacggctgtgaaatcatgtgctgcggccgagggtatgacacaactcgagtc
acccgtgtcacccagtgtgagtgcaaattccactggtgctgtgcggtgcggtgcaaggag
tgcagaaatactgtggacatccatacttgcaaggcccccaagaaggcagagtggctggac
cagacctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500238
Entry
107500238         CDS       T06036                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107500238 (WNT16)
   04390 Hippo signaling pathway
    107500238 (WNT16)
   04150 mTOR signaling pathway
    107500238 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107500238 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107500238 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107500238 (WNT16)
   05202 Transcriptional misregulation in cancer
    107500238 (WNT16)
   05205 Proteoglycans in cancer
    107500238 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107500238 (WNT16)
   05226 Gastric cancer
    107500238 (WNT16)
   05217 Basal cell carcinoma
    107500238 (WNT16)
   05224 Breast cancer
    107500238 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107500238 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    107500238 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107500238 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107500238 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107500238 (WNT16)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107500238 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107500238
NCBI-ProteinID: XP_015980743
LinkDB
Position
Unknown
AA seq 362 aa
MDRVALLGLSRLCALWAALLALFPCGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
KRKPYLLPSIREGARLGIQECRSQFRHERWNCQVSTAAPPGTSPLFGYELSSGTKETAFI
YAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFL
DFPTRNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFE
KIGHLLKDKYENSVQVSDRIKRKMRRREKDQKKELIRKDDLLYINKSPNYCVEDKKLGIP
GTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHT
CK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggacagagtggcgctcctgggactgtcacgtttgtgcgcgctgtgggcagccctgctc
gcactgttcccctgcggagcccaaggaaactggatgtggttgggcatcgcctcctttggg
gttccggagaaactgggctgcgccaacttgccgctgaacagccggcagaaggagctgtgc
aagaggaaaccgtacctgctgcccagcatccgagagggcgcccggctgggcattcaggag
tgcaggagccagtttagacacgagagatggaactgccaggtctctaccgccgccccaccg
ggcaccagtcccctctttggctacgagctgagcagcggcaccaaggaaacagcatttatt
tatgccgtgatggctgcaggcctggtgcattctgtgaccaggtcatgcagtgcaggcaac
atgacggagtgttcctgtgacaccactttgcagaatggtggctcagcaagtgaaggctgg
cattgggggggctgctccgatgatgttcagtatggcatgtggttcagcagaaagttccta
gatttccccaccagaaacaccacgggaaaagaaaacaaagtactgttagcaatgaatcta
cataacaatgaagctggaaggcaggctgtcgccaagttgatgtcagtggactgccgctgc
cacggagtttccggctcctgtgctgtgaaaacgtgctggaaaaccatgtcttcttttgaa
aaaattggccatttgttgaaggataaatatgaaaacagtgttcaagtctcagacagaata
aagaggaaaatgcgcagaagagaaaaagaccagaagaaagaattaatccgcaaggatgat
ctgctttacattaataagtctcccaattactgtgtagaggataagaaattagggatccct
ggtacacaaggcagagaatgcaaccgtacatccgagggcgcggatggatgcaacctcctc
tgctgtggccgaggctataacacccacgtggtcaggcacgtggagaggtgtgagtgcaag
tttatctggtgctgctatgttcgctgcaggaggtgtgaaagcatgacggatgtccacact
tgcaaataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500582
Entry
107500582         CDS       T06036                                 

Gene name
WNT5B
Definition
(RefSeq) protein Wnt-5b
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107500582 (WNT5B)
   04390 Hippo signaling pathway
    107500582 (WNT5B)
   04150 mTOR signaling pathway
    107500582 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107500582 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107500582 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    107500582 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107500582 (WNT5B)
   05205 Proteoglycans in cancer
    107500582 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107500582 (WNT5B)
   05226 Gastric cancer
    107500582 (WNT5B)
   05217 Basal cell carcinoma
    107500582 (WNT5B)
   05224 Breast cancer
    107500582 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107500582 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    107500582 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107500582 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107500582 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107500582 (WNT5B)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107500582 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107500582
NCBI-ProteinID: XP_015981472
LinkDB
Position
Unknown
AA seq 358 aa
MPGLLLLAAAVLSSWAQLPAEASSWWSLAMNPVQRPEMFIIGAQPVCSQLPGLSPGQRKL
CQLYQEHMAYIGEGAKTGIKECQYQFRQRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVS
AAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARER
EKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKV
GDQLKEKYDSAAAMRITRKGKLELVNSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQG
RLCNKTSEGMDGCELMCCGRGYDQFKSVQVERCHCKFHWCCFVKCKKCTEIVDQYVCK
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcccggcctgctgctgctcgctgctgcagtgctctccagctgggctcagcttccagcc
gaagccagctcctggtggtcgttagctatgaacccggtgcagagacctgagatgttcatc
atcggtgcccagcctgtgtgcagccagcttcctgggctctcccctggccagagaaagctg
tgccagttgtaccaggagcacatggcctacataggggagggagccaagacaggcatcaag
gagtgccagtaccagttccggcagaggcggtggaactgcagcaccgtggacaacacgtct
gtctttgggagggtcatgcagatagggagccgtgagaccgccttcacctatgcagtaagt
gcagcgggggtggtgaacgccatcagccgggcttgccgagagggcgagctctccacatgt
ggctgtagccggacagcacggcctaaggaccttccccgggactggctgtggggtggctgt
ggggacaacgtggagtatggctaccgctttgctaaggagtttgtggatgcccgggagcgg
gagaagaactttgccaagggatcggaggagcagggccgggtgctcatgaacctgcagaac
aacgaggcgggtcgaagggctgtgtataagatggcagacgtagcttgcaaatgccatggc
gtctcggggtcctgcagcctcaagacctgctggctccagctggctgagttccgcaaggtg
ggggaccagctgaaggagaagtacgacagcgctgccgccatgcgcatcacccgcaaaggc
aagctggagctcgtcaacagccgcttcaaccagcccacccctgaggacctggtgtacgtg
gaccccagccccgactactgcctgcgcaacgagaccacgggctccctgggcacccagggc
cgcctctgcaacaagacctcggagggcatggacggctgcgagctcatgtgctgtggccgt
ggctacgaccagttcaagagcgtccaggtggagcgctgccactgcaagttccactggtgc
tgctttgtcaagtgcaagaagtgcacggagatagtcgaccaatatgtctgtaaatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502411
Entry
107502411         CDS       T06036                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107502411 (WNT7A)
   04390 Hippo signaling pathway
    107502411 (WNT7A)
   04150 mTOR signaling pathway
    107502411 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107502411 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107502411 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107502411 (WNT7A)
   05205 Proteoglycans in cancer
    107502411 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107502411 (WNT7A)
   05226 Gastric cancer
    107502411 (WNT7A)
   05217 Basal cell carcinoma
    107502411 (WNT7A)
   05224 Breast cancer
    107502411 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107502411 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    107502411 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107502411 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107502411 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107502411 (WNT7A)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107502411 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 107502411
NCBI-ProteinID: XP_015985070
LinkDB
Position
Unknown
AA seq 349 aa
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEVYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcggtggtagctctgggcgcgagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggccggacgccatcatc
gtcataggagaaggctcacaaatgggcctcgacgagtgtcagtttcagttccgcaacggc
cgctggaactgctctgctctgggggagcgcaccgtcttcgggaaggagctcaaagtgggg
agccgagaggctgccttcacgtatgccatcattgctgccggtgtggcccatgccatcaca
gctgcctgtacccagggcaacctgagtgactgtggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttacacaataacgaggcaggccgaaagatcctggaagagaacatgaagttggagtgt
aagtgccatggcgtgtcaggctcgtgcaccaccaagacgtgctggaccacactgccacag
ttccgggagctgggctatgtgctcaaggacaagtacaatgaggccgtccatgtcgagcct
gtacgcgctagccgcaacaagcggcccaccttcctgaagatcaagaagccactgtcatac
cgcaagcccatggacacagacctggtgtacatcgagaagtcacccaactactgtgaggag
gatccagtgaccggtagtgtaggcacgcagggccgcgcctgcaacaagacagccccccaa
gccagcggctgtgacctcatgtgctgtggccgtggctacaacacccaccagtatgcccgc
gtgtggcagtgcaactgcaaattccactggtgctgctatgtcaagtgcaacacctgcagc
gaacgcacggaagtgtacacgtgcaagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503411
Entry
107503411         CDS       T06036                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a isoform X1
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107503411 (WNT5A)
   04390 Hippo signaling pathway
    107503411 (WNT5A)
   04150 mTOR signaling pathway
    107503411 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107503411 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107503411 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    107503411 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107503411 (WNT5A)
   05205 Proteoglycans in cancer
    107503411 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107503411 (WNT5A)
   05226 Gastric cancer
    107503411 (WNT5A)
   05217 Basal cell carcinoma
    107503411 (WNT5A)
   05224 Breast cancer
    107503411 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107503411 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    107503411 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107503411 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107503411 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107503411 (WNT5A)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107503411 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107503411
NCBI-ProteinID: XP_015987166
LinkDB
Position
Unknown
AA seq 388 aa
MGLERGEEGLKSIGILSPGVALGTAGSAMSSKFFLMALAIFFSFAQVVIEANSWWSLGMN
NPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRR
WNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKD
LPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYN
LADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNGRGKLVQVNSRFN
SPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQT
ERCHCKFHWCCYVKCKKCTEIVDQFVCK
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggggctcgaacgaggggaggaagggttgaagtcgattggaatattaagcccaggagtt
gctttggggacggctggaagtgcaatgtcttccaagttcttcctaatggctttggccata
tttttctccttcgcccaggttgtaatagaagccaattcttggtggtcgctaggtatgaat
aaccctgttcagatgtcagaagtatatatcataggagcacagcctctctgcagccaactg
gcgggactttctcaaggacagaagaaattatgccacttgtaccaggaccacatgcagtac
attggagaaggcgcgaagacaggcatcaaagaatgccagtatcaattccgacatcggaga
tggaactgcagcaccgtagataacacctccgtttttggcagggttatgcagataggcagc
cgcgagacggccttcacgtacgcggtgagcgccgcgggggtggtcaacgccatgagccgc
gcgtgccgcgagggcgagctgtccacctgcggctgcagccgcgccgcgcgccccaaggac
ctgccgcgggactggctgtggggcggctgcggcgacaacatcgactacggctaccgcttc
gcgaaggagttcgtggacgcgcgcgagcgagagcgcatccacgccaagggctcatacgag
agcgcgcgcatcctcatgaacctgcacaacaacgaggctggccgcaggacggtttacaac
ctggctgatgtggcctgcaagtgccacggggtgtccggctcatgtagcctcaagacgtgc
tggctacagctggcagacttccgcaaggtgggcgacgccctgaaggagaagtatgacagc
gctgcggccatgcgcctcaatggcaggggcaagctggtgcaggtcaacagccgcttcaac
tcgcccaccacacaggacctggtctacatcgaccccagccctgactactgcgtgcgcaat
gagagcacgggctcactgggcacacaaggccgcctatgcaacaagacgtccgagggcatg
gacggctgcgagctcatgtgctgtggccgcggctatgaccagttcaagaccgtgcagaca
gagcgctgccattgcaagttccactggtgttgctacgtcaagtgcaagaagtgcacggag
attgtggaccagtttgtgtgcaagtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505364
Entry
107505364         CDS       T06036                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2 isoform X1
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107505364 (WNT2)
   04390 Hippo signaling pathway
    107505364 (WNT2)
   04150 mTOR signaling pathway
    107505364 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107505364 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107505364 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107505364 (WNT2)
   05205 Proteoglycans in cancer
    107505364 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107505364 (WNT2)
   05226 Gastric cancer
    107505364 (WNT2)
   05217 Basal cell carcinoma
    107505364 (WNT2)
   05224 Breast cancer
    107505364 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107505364 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    107505364 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107505364 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107505364 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107505364 (WNT2)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107505364 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107505364
NCBI-ProteinID: XP_015990958
LinkDB
Position
Unknown
AA seq 482 aa
MRRSSSSPPPARTHISGSPRRASQAGGGLLRPRKRAVEQFTAAASSWSSFLSGDKRRGCK
PIAAQDAPPAGASLSLSPLCRGPDPGRRRSFCLHKAQRLRARAAGGATHGRLFAASVPPS
VIFCAPQRWGGAGCASKPHLPRTLWPGTPGYMKATGGSSRVMCDNVPGLVSRQRQLCHRH
PDVMRAIGLGVAEWMAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAG
VVFAITRACSQGELKSCSCDPKKKGTAKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERK
GKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKY
NGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSLGTAGRVCNLTS
RGMDSCEVMCCGRGYDTSRVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWAA
TT
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgcggcgctcgtcttcatccccgcccccagcacgcacacacatttcgggttccccaagg
cgtgcttcccaggcgggcggcgggctcctccgccctaggaaaagagcagtggaacagttc
acggccgccgcgagttcctggtcttccttcctttccggtgataaacggcggggctgcaag
ccaattgctgctcaagatgctccacccgcgggcgcgagcctctctctctctccgctctgc
aggggcccagatccaggacggagaaggtccttttgcctccacaaagctcaaaggctgaga
gccagggcggcgggaggcgcgacccacggcaggctcttcgctgcctcggtgcctccctcc
gtgatcttttgcgctccacagcgttggggaggagctgggtgtgcgtcaaaaccgcatctt
ccccggacgctttggccggggacgcctgggtacatgaaagcgacaggcggctcctccagg
gtgatgtgcgacaatgtgccagggctggtgagccgccagcggcagctgtgccaccgacac
ccagatgtgatgcgtgccattggcctgggtgtggccgagtggatggccgagtgccagcac
cagttccgccagcaccgctggaactgcaacaccctggacagggaccacagcctctttggc
agagtcctgctccgaagtagtcgggaatctgcctttgtttacgccatctcctcagctgga
gttgtatttgccatcaccagggcctgtagccaaggagaattaaaatcctgttcctgtgat
ccaaagaagaagggaaccgccaaggacagcaagggcactttcgactggggtggctgcagt
gataacattgactatgggatcaaatttgctcgagcgtttgtggacgccaaggaaaggaaa
ggaaaggacgccagagccctgatgaatctgcacaacaacagagctggccggaaggctgta
aagaggtttttgaaacaagagtgcaagtgtcacggcgtgagcggctcatgcaccctgcgg
acatgctggctggccatggccgacttcagaaaaacgggtgattatctgtggaggaagtac
aacggggccatccaggtcgtcatgaaccaggacggcactggctttactgtggctaacaag
aggtttaagaagccaacgaaaaacgacctcgtgtattttgagaattctccagactactgt
atcagggaccgagatgcaggctccctgggtacagcaggacgtgtgtgcaacctgacctcc
cgaggcatggacagctgtgaagtcatgtgctgcgggagaggctacgacacctcccgcgtc
acgaggatgaccaagtgtgagtgtaagttccactggtgctgtgctgtccgctgtcaggac
tgcctggaggccctggacgtgcacacgtgcaaggcacctaagagtgccgactgggcggct
accacatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505517
Entry
107505517         CDS       T06036                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107505517 (WNT7B)
   04390 Hippo signaling pathway
    107505517 (WNT7B)
   04150 mTOR signaling pathway
    107505517 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107505517 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107505517 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107505517 (WNT7B)
   05205 Proteoglycans in cancer
    107505517 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107505517 (WNT7B)
   05226 Gastric cancer
    107505517 (WNT7B)
   05217 Basal cell carcinoma
    107505517 (WNT7B)
   05224 Breast cancer
    107505517 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107505517 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    107505517 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107505517 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107505517 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107505517 (WNT7B)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107505517 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107505517
NCBI-ProteinID: XP_015991189
LinkDB
Position
Unknown
AA seq 353 aa
MLLLSPRSALLSVYCPQIFLILSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRP
DAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVA
HAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNA
RRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAV
QVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNR
TSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctcctgctgtcgccgcgcagcgcgctcctctccgtctactgcccgcagatctttctc
atcttgtccagcggcagctacctagcgctgtcgtctgtcgtggccctgggagccaacatc
atctgcaacaagattccgggcctggccccgcggcagcgtgccatctgccagagccggccc
gatgccatcatcgtgatcggggagggggcacagatgggcatcaacgagtgccagtaccag
ttccgcttcggacgctggaactgctctgctctcggtgagaagactgtcttcgggcaggag
ctccgagtagggagccgagaggccgcgttcacctacgccatcaccgcggccggcgtggcg
cacgcggtcaccgcggcctgcagccagggcaacctgagcaactgcgggtgcgaccgcgag
aagcagggctactacaaccaggccgagggctggaagtggggcggctgctccgccgacgtg
cgctacggcatcgacttctcccggcgcttcgtggacgcgcgcgagatcaagaagaacgcg
cggcgcctcatgaacctgcacaacaacgaggcgggcaggaaggtcctggaggagcgcatg
aagctggagtgcaagtgccacggcgtgtcgggctcctgcaccaccaagacgtgctggacc
acactgcccaagttccgagaggtgggccacctgctcaaggagaagtacaacgcggccgtg
caggtggaggtggtgcgggccagccgcctgcggcagcccaccttcctgcgcatcaagcag
ctgcgcagctaccagaagcccatggagacggacctggtgtacatcgagaagtcgcccaac
tactgcgaggaggacgcggccaccggcagcgtgggcacgcagggccgcctgtgcaaccgc
acctcgcccggcgcggacggctgcgacaccatgtgctgcggccgcggctacaacacccac
cagtacaccaaggtctggcagtgcaactgcaagttccactggtgctgcttcgtcaagtgc
aacacctgcagcgagcgcactgaggtcttcacctgcaagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508172
Entry
107508172         CDS       T06036                                 

Gene name
WNT9B
Definition
(RefSeq) protein Wnt-9b
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107508172 (WNT9B)
   04390 Hippo signaling pathway
    107508172 (WNT9B)
   04150 mTOR signaling pathway
    107508172 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107508172 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107508172 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508172 (WNT9B)
   05205 Proteoglycans in cancer
    107508172 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107508172 (WNT9B)
   05226 Gastric cancer
    107508172 (WNT9B)
   05217 Basal cell carcinoma
    107508172 (WNT9B)
   05224 Breast cancer
    107508172 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107508172 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    107508172 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107508172 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107508172 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107508172 (WNT9B)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107508172 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107508172
NCBI-ProteinID: XP_015995308
LinkDB
Position
Unknown
AA seq 358 aa
MRPPPALALAALCLLALPAAAAAAYFGLTGREVLTPFPGLGTVAAPAQGGAHLKQCDLLK
LSRRQKQLCRREPGLADTLRDAAHLSLLECQFQFRLERWNCSLEGRTGLLKRGFKETAFL
YAVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGP
KRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQALK
LRYDSAVKVSSATNEALGRLELWAPAKPGSPTKGLAPRSGDLVYMEDSPSFCRPSKYSPG
TAGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcgccccccgcccgcgctggccctggccgcgctctgcctgctggcgctgcccgccgcc
gccgctgccgcctacttcggcctgaccgggcgagaagtcctgacgcccttcccagggctg
ggcaccgtggcagccccagcacagggtggggcccacctgaagcagtgtgacctgctgaag
ctgtcccgtcggcagaagcagctctgtcggcgggagcccggcctcgctgacaccctgcgg
gatgccgcccacctgagcctgctcgagtgccagttccagttccgcctggagcgctggaac
tgcagcctggaggggaggacgggcctgctcaagagaggttttaaggagacggccttcctg
tacgcggtatcctcggccgccctcacccacactttggcccgggcctgcagtgccggtcgc
atggagcgctgcacctgcgacgactctcccggcctggagagtcggcaggcctggcagtgg
ggcgtgtgtggcgacaacctcaagtacagcaccaagttcctgagcaacttcctggggccc
aagagaggaagcaaagacctccgggcgcgggcggacgcccataacacccacgtgggcatc
aaggccgtgaagagtggcctcaggaccacgtgtaagtgccatggcgtatcgggctcctgt
gccgtgcgcacttgctggaagcagctctccccattccgagagaccggccaggccctgaag
ctgcgctacgactcagccgtcaaggtgtccagtgccacgaacgaggccttgggacgccta
gagctgtgggcacctgccaagccaggcagccccaccaagggcctggccccgcggtcaggg
gacctggtctacatggaggactcacccagcttctgccggcccagcaagtactcccctggc
acggcgggcagggtgtgctcccgggaggccagctgcagcagcctgtgctgcgggcggggc
tatgacacccagagccgcctggtggccttctcctgccactgccaggtgcagtggtgctgc
tatgtggagtgccagcagtgcgtgcaggaggagctcgtgtacacctgtaagcactag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508173
Entry
107508173         CDS       T06036                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107508173 (WNT3)
   04390 Hippo signaling pathway
    107508173 (WNT3)
   04150 mTOR signaling pathway
    107508173 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107508173 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107508173 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508173 (WNT3)
   05206 MicroRNAs in cancer
    107508173 (WNT3)
   05205 Proteoglycans in cancer
    107508173 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107508173 (WNT3)
   05226 Gastric cancer
    107508173 (WNT3)
   05217 Basal cell carcinoma
    107508173 (WNT3)
   05224 Breast cancer
    107508173 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107508173 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    107508173 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107508173 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107508173 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107508173 (WNT3)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107508173 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107508173
NCBI-ProteinID: XP_015995309
LinkDB
Position
Unknown
AA seq 355 aa
MEPHLLGLLLGLLLCGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECVRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctctgtggcaccagggtcctc
gccggctacccaatttggtggtccctggccctgggccagcagtacacgtccctgggctct
cagcctctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgaaatcatgcccagcgtggccgagggcgtgaagctaggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgtaccaccatcgatgacagcctggccatc
tttgggcctgtcctcgacaaagccacccgcgaatcggccttcgttcacgccatcgcctct
gctggcgtggccttcgcggtcacgcgctcctgtgccgagggcacctccaccatctgcggc
tgcgattcgcatcataaggggccgcccggcgagggctggaagtggggcggctgtagcgag
gacgccgacttcggggtgctcgtgtcccgggagtttgcggacgcgcgggagaacaggccg
gacgcgcgctcagccatgaacaagcacaacaatgaggcaggccgcacgaccatcctggac
cacatgcacctcaagtgcaagtgtcacgggctgtcgggcagctgcgaggtgaagacctgc
tggtgggcccagcccgacttccgggccatcggtgacttcctcaaggacaagtatgacagc
gcctctgagatggtggtggagaagcaccgcgagtcccgcggctgggtggagacgctccgc
gccaagtacgccctcttcaagccgcccaccgagagggacctggtctactatgagaactcc
cccaacttttgcgagcccaaccctgagacgggctcctttggcaccagggaccggacttgc
aatgtcacctcccacggcatcgatggctgtgacctgctgtgctgcggccgcggccacaac
acgaggacggagaagcggaaggagaaatgccactgcatcttccactggtgctgctacgtg
agctgccaggagtgcgtccgcatctacgacgtgcacacctgcaagtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509667
Entry
107509667         CDS       T06036                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107509667 (WNT3A)
   04390 Hippo signaling pathway
    107509667 (WNT3A)
   04150 mTOR signaling pathway
    107509667 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107509667 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107509667 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509667 (WNT3A)
   05206 MicroRNAs in cancer
    107509667 (WNT3A)
   05205 Proteoglycans in cancer
    107509667 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107509667 (WNT3A)
   05226 Gastric cancer
    107509667 (WNT3A)
   05217 Basal cell carcinoma
    107509667 (WNT3A)
   05224 Breast cancer
    107509667 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107509667 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    107509667 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107509667 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107509667 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107509667 (WNT3A)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107509667 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107509667
NCBI-ProteinID: XP_015997867
LinkDB
Position
Unknown
AA seq 352 aa
MALLRYFLFLYGLKQALGSYPIWWSLAVGPQYSSLGMQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGLRVSIQECQHQFRGRRWNCTTVNNSLAIFGPVLDKATRESAFVHAIAAAGV
AFAVTRSCAEGSATICGCSSRHQSSPGDGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDLLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SPGIDGCDLLCCGRGHNARAERRREKCHCVFHWCCYVSCQECARVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccctgctccggtacttcttattcctctacggcctgaagcaggcgctgggcagctac
cctatctggtggtccctggccgttgggccccagtattcatctctgggcatgcagcccatc
ctctgtgccagcatcccgggcctggtccccaagcagctgcgcttctgccggaactacgtt
gagatcatgcccagcgtggcagaaggccttcgggtcagcatccaggagtgccagcaccag
ttccgcggtcgccggtggaactgcaccaccgtcaacaacagcctggccatcttcggcccc
gtgctggacaaagccacccgcgaatctgcctttgtgcacgccatcgctgctgctggcgtg
gccttcgcggtgacgcgctcctgcgctgagggctccgccaccatctgcggctgcagcagc
cgccaccagagctcaccgggagacggctggaagtggggcggctgcagcgaggatatcgag
ttcggcggcatggtgtctcgggagttcgcggatgcacgggagaacaggcctgacgcccgc
tctgcaatgaaccgccataacaatgaggccgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacttgctggtggtcg
cagcccgacttccgcgccatcggcgacctcctcaaggacaagtacgacagtgcctcggaa
atggtagtggagaagcaccgcgaatcgcgcggctgggtggagactctgcggccgcgctac
acctacttcaaggtgcccaccgagcgcgacctggtctactacgaggcctcgcccaacttc
tgcgagcccaaccccgagaccggctcctttggcactcgcgaccgcacctgcaacgtgagc
tcgccgggcattgacggctgcgatttgctgtgctgtggccgaggtcacaacgcgcgcgca
gagcggcgccgggagaagtgccactgcgtctttcactggtgctgctacgtgagctgccag
gagtgcgcgcgcgtctacgatgtgcacacttgcaagtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509675
Entry
107509675         CDS       T06036                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107509675 (WNT9A)
   04390 Hippo signaling pathway
    107509675 (WNT9A)
   04150 mTOR signaling pathway
    107509675 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107509675 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107509675 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107509675 (WNT9A)
   05205 Proteoglycans in cancer
    107509675 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107509675 (WNT9A)
   05226 Gastric cancer
    107509675 (WNT9A)
   05217 Basal cell carcinoma
    107509675 (WNT9A)
   05224 Breast cancer
    107509675 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107509675 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    107509675 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107509675 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107509675 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107509675 (WNT9A)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107509675 (WNT9A)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 107509675
NCBI-ProteinID: XP_015997878
LinkDB
Position
Unknown
AA seq 364 aa
MLDGPLLARWLAAAFALTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEATAQAHYKACD
RLKLERKQRRMCRRDPGVVETLVEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KRLKHKYETALKVGSTTNEAAGEAGAISPPRGRATGTGGDPLPRTPELVHLDDSPSFCLA
GRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVY
TCKG
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgctggatgggcccctgctggcgcgctggctggccgcggccttcgcgctgacgctgctg
ctcgctgcactgcgcccctcggccgcctacttcgggctgactggcagcgagcccctgacc
atcctcccgctgaccctggagcccgaggccactgcgcaggcacactacaaggcctgtgac
cggctgaagctggagaggaagcagcggcgcatgtgccgccgggacccgggcgtggtcgag
acgctggtggaggcggtcagcatgagcgcgcttgagtgccagtaccagttccgcttcgag
cgctggaactgcaccctggagggccgctaccgggccagcctgctcaagcgaggcttcaag
gagaccgccttcctctacgccatctcctcagctggcctgacacatgcgctggccaaggcc
tgcagtgcaggccgcatggagcgttgcacctgtgatgaggcccctgacttggagaaccgt
gaggcctggcagtggggtggctgtggagacaacctcaagtacagcagcaagtttgtcaag
gagttcctgggccggcggtcgagcaaggacctgcgcgcccgagtggatttccacaacaac
ctcgtgggtgtgaaggtaatcaaggccggggtggagaccacatgcaaatgccacggcgtg
tcgggctcgtgcactgtgcggacgtgctggcgacagctggcacccttccatgaggtgggc
aagcgcctgaagcacaagtatgagacggcactcaaggtgggcagcaccaccaatgaggct
gccggcgaggctggcgccatctcaccgccaaggggccgggccacgggcacgggtggtgac
cctctgccccgcacgccggagctcgtgcacctggatgactcgcccagcttctgccttgct
ggccgcttctccccgggcaccgctggccgcaggtgtcaccgtgagaagaactgcgagagc
atctgctgtgggcgtggccacaacacacagagccgggtggtgacacggccgtgccagtgc
caagtgcgttggtgctgctatgtggagtgtaggcagtgcacgcagcgtgaggaggtctat
acctgcaagggctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513057
Entry
107513057         CDS       T06036                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4 isoform X1
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04919  Thyroid hormone signaling pathway
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107513057 (WNT4)
   04390 Hippo signaling pathway
    107513057 (WNT4)
   04150 mTOR signaling pathway
    107513057 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107513057 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107513057 (WNT4)
   04916 Melanogenesis
    107513057 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    107513057 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107513057 (WNT4)
   05205 Proteoglycans in cancer
    107513057 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107513057 (WNT4)
   05226 Gastric cancer
    107513057 (WNT4)
   05217 Basal cell carcinoma
    107513057 (WNT4)
   05224 Breast cancer
    107513057 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107513057 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    107513057 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107513057 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107513057 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107513057 (WNT4)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107513057 (WNT4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 107513057
NCBI-ProteinID: XP_016004764
LinkDB
Position
Unknown
AA seq 351 aa
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagtccccgctcgtgcttgcgttcgctgcgcctcctcgtcttcgccgtcttctccgcc
gccgcgagcaactggctgtacctggccaagctgtcctcggtggggagcatctcggaggag
gagacctgcgagaagctcaagggcctgatccagaggcaggtgcaaatgtgcaagcggaac
ctggaggtgatggactcggtgcgccgcggcgcccagctggccattgaggagtgccagtac
cagttccggaaccggcgctggaactgctccacgctcgactcgctgcctgtcttcggcaaa
gtggtgacgcaagggactcgggaggcggccttcgtgtacgccatctcttcagcaggtgtg
gcctttgcggtgacgcgggcgtgcagcagtggggagctagaaaagtgtggctgtgaccgg
acggtacacggggtcagcccacagggcttccagtggtcaggatgctcagacaacatcgcc
tacggcgtggccttctcccagtcattcgtggacgtgcgggagagaagcaagggcgcctcg
tccagccgggccctcatgaacctccacaacaacgaagccggcaggaaggccatcttgaca
cacatgcgggtagagtgcaagtgccatggggtatcgggctcctgcgaggtaaagacatgc
tggcgagccgtgccgcccttccgtcaggtgggccacgcactgaaggagaagttcgatggc
gccaccgaggtggagccacgccgtgtggggtcctccagggcgctggtgccgcgcaacgca
cagttcaagccgcatacagatgaggacctggtgtacttggagcccagcccagacttctgc
gagcaggacatgcgcagcggcgtgctgggcacgaggggccgcacgtgcaacaagacgtcc
aaggccatcgacggctgtgagctgctgtgctgtggccgcggcttccacacggcacaggtg
gagctggctgagcgctgcagctgcaaattccactggtgctgctttgtcaagtgccggcag
tgccagcggctggtggagctgcacacatgccggtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514289
Entry
107514289         CDS       T06036                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107514289 (WNT10B)
   04390 Hippo signaling pathway
    107514289 (WNT10B)
   04150 mTOR signaling pathway
    107514289 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107514289 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107514289 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514289 (WNT10B)
   05205 Proteoglycans in cancer
    107514289 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107514289 (WNT10B)
   05226 Gastric cancer
    107514289 (WNT10B)
   05217 Basal cell carcinoma
    107514289 (WNT10B)
   05224 Breast cancer
    107514289 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107514289 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    107514289 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107514289 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107514289 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107514289 (WNT10B)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107514289 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107514289
NCBI-ProteinID: XP_016007341
LinkDB
Position
Unknown
AA seq 389 aa
MQEEPGPRLPPWGFAGLLFLALCTRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSGPSPSPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRATPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTVGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgcaggaggagcccggtccgcggcttccaccctggggtttcgcgggtctcctgttcctg
gcgttgtgcactcgggctctaagcaatgagatcctgggcctgaagttgcccggcgagccg
ccgctgactgccaacacagtgtgcttgacgctgtcgggcctcagcaagcggcagctaggc
ctgtgcctgcgcagccccgacgtgacagcgtccgcacttcagggcctgcacatcgctgtc
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctcggcgctcgagggcggc
ggtcgcctgccgcaccacagcgccatcctcaagcgcggtttccgtgagagtgctttttcc
ttctccatgctggctgctggggtcatgcacgcggtagccacggcctgcagcctgggcaag
ctggtgagctgcggctgtggctggaagggcagtggtgagcaggatcggctgagggccaaa
ttgctgcagctgcaggccctgtcccggggcaagagtttcccccactctctgcccagcccg
ggccctggctcaggccccagccctagtccccaggacacatgggaatggggaggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcacgaatgcgaatccacaacaacagggtggggcgccaggtggtaact
gaaaacctgaagcggaaatgcaagtgccatggcacatcaggaagctgccagttcaagacc
tgctggagggctaccccagagttccgggcagtgggagcagcgctgagggaacgcctgggc
cgggccatcttcattgatacccacaaccgcaactctggagcctttcagccccgccttcgt
ccccgtcgcctttcaggagagctggtttactttgagaagtctcctgacttctgtgagcga
gaccccactgtgggctccccaggcacgcggggccgggcctgcaacaagactagccgcctg
ctggatggctgtggcagcctgtgttgtggccgtgggcacaatgtgctccggcagacacga
gttgaacgctgtcattgtcgcttccactggtgctgctatgtgctgtgtgatgaatgcaaa
gtcacagagtgggtcaatgtgtgtaagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514294
Entry
107514294         CDS       T06036                                 

Gene name
WNT1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107514294 (WNT1)
   04390 Hippo signaling pathway
    107514294 (WNT1)
   04150 mTOR signaling pathway
    107514294 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107514294 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107514294 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514294 (WNT1)
   05205 Proteoglycans in cancer
    107514294 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107514294 (WNT1)
   05226 Gastric cancer
    107514294 (WNT1)
   05217 Basal cell carcinoma
    107514294 (WNT1)
   05224 Breast cancer
    107514294 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107514294 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    107514294 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107514294 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107514294 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107514294 (WNT1)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107514294 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107514294
NCBI-ProteinID: XP_016007344
LinkDB
Position
Unknown
AA seq 370 aa
MGHWALLPGWFSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTASGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggcactgggcgctgctgcctggttggttttctgctacgctgttgctggcgctggcc
gctctgcctgcagccctggccgccaacagcagtggccgatggtggggcatcgtgaacgta
gcctcctccacgaacctactgaccgactccaaaagtctgcaactggtgctcgaacccagt
ctgcagctgctgagccgcaaacagcggcgactaatccgccagaacccagggatcctgcac
agtgtgagcggggggctgcagagcgctgtgcgagagtgcaagtggcagttccggaaccgc
cgctggaactgccccacggcatcggggccgcacctcttcggcaagatcgtcaaccgaggt
tgtcgggaaacagcatttatcttcgccatcacctccgctggggttacccattcggtggcg
cgctcctgttcggagggctccatcgagtcctgcacgtgcgattaccggcggcgcggccct
ggtggccccgattggcactgggggggctgcagcgacaatatcgactttggccgcctcttc
ggccgggagttcgtggattccggagagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcgggacgcacgaccgtgttttccgagatgcgccaggagtgcaagtgc
catgggatgtcgggctcctgcaccgtgcgcacgtgctggatgcggctacccacgctgcgc
gcggtgggcgacgtgctgcgcgaccgcttcgatggcgcctcgcgcgtcctctacggcaac
cgcggcagcaaccgcgcgtcacgcgcggagctgctgcgcctcgagcctgaagaccccgcg
cacaagccgccctccccccacgacctcgtctacttcgagaaatcgcccaacttctgcaca
tacagtggacgcctgggtacagcgggcacggcggggcgcgcctgcaacagctcgtctccc
gcactggatggctgcgagctgctctgctgcggccgaggccaccgcacgcgcacgcagcgc
gtcactgaacgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtcctgcatgagtgcctgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516694
Entry
107516694         CDS       T06036                                 

Gene name
WNT10A
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107516694 (WNT10A)
   04390 Hippo signaling pathway
    107516694 (WNT10A)
   04150 mTOR signaling pathway
    107516694 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107516694 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107516694 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107516694 (WNT10A)
   05205 Proteoglycans in cancer
    107516694 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107516694 (WNT10A)
   05226 Gastric cancer
    107516694 (WNT10A)
   05217 Basal cell carcinoma
    107516694 (WNT10A)
   05224 Breast cancer
    107516694 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107516694 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    107516694 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107516694 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107516694 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107516694 (WNT10A)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107516694 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 107516694
NCBI-ProteinID: XP_016012150
LinkDB
Position
Unknown
AA seq 417 aa
MGSTHPCPWPRLQPRPQPRPALCALLFFLLLLAAAVPRSAPNDILGLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLRACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPPISPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGVAGPRRRANSADLVYFEKSPDFCEHEPRLDSAGTVGR
LCNKSSSGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcacccacccttgcccctggcctcggctccaacctcggccccagccacggcct
gcgctctgcgcgctcctgttctttctactgctgctcgctgccgctgtgcccaggtctgca
ccaaacgacattctgggcctccgccttcccccggagcctgtgctcaacgccaacacagtg
tgcctgacactgcccggcctgagcaggcgtcagatggaggtgtgtgtgcgccaccccgat
gtggctgcctcagccatccagggcatccagattgcgatccacgagtgccagcaccagttc
cgggaccagcgctggaactgctctagtctcgagactcgaaacaagatcccctacgagagt
cccatcttcagcagaggtttccgagagagcgcctttgcttatgccatagcagctgcggga
gtagttcacgcggtatccaatgcctgcgccctgggaaaactgagggcatgcggctgcgac
gcatccaggcgcggggacgaggaggcgttccgtcggaagctgcaccgcctgcagctggac
gcgctgcagcgtggtaagggcctgagccacggggttcccgagcacccagccctgccccct
atcagccctggcctgcaggactcctgggagtggggcggctgcagtcctgacgtgggcttc
ggggagcgcttctctaaggactttctggactcccgggagcctcatagagacatccacgca
cgcatgaggctccacaacaaccgagtggggaggcaggcagtgatggagaacatgcggcga
aaatgcaagtgccacggcacgtcaggcagctgccagctcaagacgtgctggcaggtgacg
ccggagttccgcgccgtgggggcgctgctgcgcagccgctttcaccgcgccacgctcatc
cggccgcacaaccgcaacggcggccagctggagccgggccccgcgggggcaccctctccg
gcccctggcgttgctgggccgcgccgccgggccaactccgccgacctggtctacttcgag
aagtcgcctgacttctgcgagcacgagccgcgcctggactctgcaggcaccgtgggccgc
ctgtgcaacaagagcagctcaggccccgacggctgtggcagcatgtgctgtggtcgtggc
cacaacatcctgcgccagacgcgcagtgagcgctgccactgccgcttccactggtgctgt
ttcgtggtctgcgaggagtgccgcatcaccgaatgggtcagcgtctgcaagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516780
Entry
107516780         CDS       T06036                                 

Gene name
WNT6
Definition
(RefSeq) protein Wnt-6 isoform X1
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107516780 (WNT6)
   04390 Hippo signaling pathway
    107516780 (WNT6)
   04150 mTOR signaling pathway
    107516780 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107516780 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107516780 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107516780 (WNT6)
   05205 Proteoglycans in cancer
    107516780 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107516780 (WNT6)
   05226 Gastric cancer
    107516780 (WNT6)
   05217 Basal cell carcinoma
    107516780 (WNT6)
   05224 Breast cancer
    107516780 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107516780 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    107516780 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107516780 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107516780 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107516780 (WNT6)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107516780 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107516780
NCBI-ProteinID: XP_016012365
LinkDB
Position
Unknown
AA seq 365 aa
MLPPVPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQTEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCKAPRGKAPPRPLGLPGTPGPPGLTGSQDGSAAWEWGGCGDDVDFGD
EKSRLFMDAQHKRGRGDIRVLVQLHNNEAGRLAVRSHMRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVLSLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCHVRKE
LSLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgccgcccgtgccctcccgcctcgggctgctgctgctgctgcttctgtgtcccgcg
cacgtcggcggactgtggtgggcagtgggcagccccttggtcatggaccctaccagcatc
tgcaggaaggcacggaggttggcagggcggcaggctgagttgtgccaaacagagccagaa
gtggtggctgagctggcacggggtgcccggctgggggttcgagagtgccagttccagttc
cgattccgccgctggaactgctccagccacagcaaggcctttgggcgcatcttgcagcag
gacatccgggagactgccttcgtgtttgctattactgctgcaggcgccagccacgcggtc
acgcaggcctgctccatgggcgagctgctgcagtgcggctgcaaggcaccccgcgggaag
gccccgccacggcccctgggcctgccaggcacccctgggccccctggcctcacaggatcc
caagatggcagtgccgcctgggagtggggaggctgtggcgatgacgtggacttcggggac
gagaagtctaggctctttatggatgcgcagcacaagcggggacgtggagacatccgtgtg
ttggtgcaacttcacaacaatgaggcgggccgcctggccgtgcggagccatatgcgcacc
gagtgcaaatgccacggactgtcgggctcgtgcgcgttgcgcacctgctggcagaagctg
cccccgttccgcgaggtgggcgcgcggctgctcgagcgcttccacggcgcctcgcgtgtc
atgggcaccaacgatggcaaagctctgctgcccgccgtcctcagtctcaagccgccgggc
cgcgctgacctactctacgccgccgactcgcctgacttctgcgcccccaaccggcgcacg
ggctcccccggcacgcgcggccgcgcctgcaacagcagtgccccggacctcagcggctgc
gacctgctgtgctgcggccgcgggcaccgccaggagagcgtgcagctcgaggagaactgc
ctgtgtcgcttccactggtgctgcgtagtgcagtgccaccgctgccacgtgcgcaaggag
ctcagtctctgcctttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518710
Entry
107518710         CDS       T06036                                 

Gene name
WNT8A
Definition
(RefSeq) LOW QUALITY PROTEIN: protein Wnt-8a
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107518710 (WNT8A)
   04390 Hippo signaling pathway
    107518710 (WNT8A)
   04150 mTOR signaling pathway
    107518710 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107518710 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107518710 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518710 (WNT8A)
   05205 Proteoglycans in cancer
    107518710 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107518710 (WNT8A)
   05226 Gastric cancer
    107518710 (WNT8A)
   05217 Basal cell carcinoma
    107518710 (WNT8A)
   05224 Breast cancer
    107518710 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107518710 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    107518710 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107518710 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107518710 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107518710 (WNT8A)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107518710 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107518710
NCBI-ProteinID: XP_016016096
LinkDB
Position
Unknown
AA seq 417 aa
MLCHLECLCLVSXFPSPLTLCQGSSHYLTPVHHCLIFSLFGRSVNNFLITGPKAYLTYTT
SVALGAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATKETSFIHAISSAGVMYTIT
KNCSMGDFENCGCDESKNGKTGGHGWVWGGCSDNVEFGEKISKLFVDSLEKGKDARALMN
LHNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLADFREMGDYLKAKYDQALKIEMD
KRRLRAGNSAEGHWAPAEAFFPSAEAELIFLEESPDYCIRNSSLGIYGTEGRECLQNSHN
TSRREQPSCGHLCTECGLQVEEKRTEAISSCNCKFQWCCTVKCDQCWHVTMSNPAVLLRI
RXLEAKNEKVLSKLLKEQLSPTLASSRKTSVQVHADKWGQRLHTCLLEGFQSVGFFT
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgctatgccaccttgagtgtctctgcctggtaagtntcttcccctcacctctcactctc
tgccaaggaagctcccattatctcacccctgttcaccattgcctcattttttctcttttt
ggtaggtcagtgaacaatttcctgataacaggtcccaaggcctacctgacctatactacc
agcgtggccctaggtgcccagagtggcatcgaggagtgtaagttccaatttgcctgggaa
cgctggaactgccctgaaaatgctctccagctctccactcacaacaggctgagaagtgcc
accaaggagacttcattcattcatgctatcagctctgctggagtcatgtacaccatcacc
aagaactgtagcatgggtgactttgaaaactgtggctgtgatgagtcaaaaaacggaaaa
acaggaggccatggttgggtctggggaggctgcagcgacaacgtagaatttggggaaaag
atctccaaactctttgtggacagcctggagaagggaaaggatgccagagccctgatgaat
cttcacaacaacagggcaggaaggctggcagttagagccactatgaaaaggacctgcaaa
tgccatggcatctcaggaagctgcagcatccagacatgctggctgcagctggctgacttt
cgggagatgggagactacttaaaagccaagtatgaccaagcgctgaaaattgagatggat
aagcggcggctaagggctgggaacagtgctgagggccactgggcacccgctgaagccttc
tttcctagtgcagaggccgagctgatctttttagaggaatcaccagattactgtatccgc
aattctagcctgggcatctacggcacagagggtcgggagtgtctgcagaatagccacaac
acatccaggcgggaacaacccagctgcgggcacttgtgcactgagtgtggcctgcaggtg
gaagagaagagaactgaggccatcagcagctgtaactgcaaattccagtggtgttgtaca
gtcaagtgtgaccagtgttggcatgtgaccatgtccaacccagctgtgctgctgagaatc
aggngattggaagcaaaaaatgaaaaagttctgtccaaactactgaaggagcaactttcc
cctactctagctagctccagaaagaccagcgtacaagttcatgcagataagtgggggcag
agactacatacctgcctactggaaggttttcagagtgttgggtttttcacctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519202
Entry
107519202         CDS       T06036                                 

Gene name
WNT11
Definition
(RefSeq) LOW QUALITY PROTEIN: protein Wnt-11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107519202 (WNT11)
   04390 Hippo signaling pathway
    107519202 (WNT11)
   04150 mTOR signaling pathway
    107519202 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107519202 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107519202 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519202 (WNT11)
   05205 Proteoglycans in cancer
    107519202 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107519202 (WNT11)
   05226 Gastric cancer
    107519202 (WNT11)
   05217 Basal cell carcinoma
    107519202 (WNT11)
   05224 Breast cancer
    107519202 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107519202 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    107519202 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107519202 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107519202 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107519202 (WNT11)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107519202 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 107519202
NCBI-ProteinID: XP_016017113
LinkDB
Position
Unknown
AA seq 354 aa
MRARLQVCEALLFALVLQTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTVVHAAREVMKACRKAFSDMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCAPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSHGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggctgcaggtctgcgaggcgcttctcttcgccctggtgctccagaccggc
gtgtgctatggcatcaagtggctggcgctgtccaagacgccggcagccctggcgctgaac
cagacgcagcactgcaagcagctggagggcctggtgtccgcgcaggtgcagctgtgccgc
agcaacctggagctgatgcacaccgtcgtgcacgccgcccgcgaggtcatgaaggcctgt
cgcaaggccttctcggacatgcgctggaactgctcctctatcgagcttgcccccaactac
ctgcttgacctggagagagggacccgggagtctgccttcgtgtatgcgctgtcggcagcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgcctggctgctcctgc
gcgcctgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgtgcttctctggaaatgaagtgtaaatgccacggggtatctggctcctgctctatc
cgcacctgctggaaggggctacaggagcttcgagatgtggccgctgacctcaagacccgc
tacctgtcggccaccaaggtagtgcaccgacccatgggcacccgcaagcacctggtgccc
aaggacctggacatccggcctgtgaaggactcagagctcgtctatctgcagagctcacct
gacttctgtatgaagaatgagaaggtgggctcccatgggacgcaagacaggcaatgcaac
aagacatcccacggcagtgacagctgtgatctcatgtgctgtggacgcggctacaacccc
tatacagaccgcgtggtcgagcggtgccactgcaagtaccactggtgctgctatgtcacc
tgccgcaggtgtgagcgcacggtggagcgctacgtctgcaagtga

DBGET integrated database retrieval system