KEGG   Rousettus aegyptiacus (Egyptian rousette): 107499884
Entry
107499884         CDS       T06036                                 

Gene name
RAPGEF3
Definition
(RefSeq) rap guanine nucleotide exchange factor 3 isoform X1
  KO
K08014  Rap guanine nucleotide exchange factor 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04072  Phospholipase D signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04670  Leukocyte transendothelial migration
ray04720  Long-term potentiation
ray04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107499884 (RAPGEF3)
   04072 Phospholipase D signaling pathway
    107499884 (RAPGEF3)
   04024 cAMP signaling pathway
    107499884 (RAPGEF3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107499884 (RAPGEF3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107499884 (RAPGEF3)
  09156 Nervous system
   04726 Serotonergic synapse
    107499884 (RAPGEF3)
   04720 Long-term potentiation
    107499884 (RAPGEF3)
SSDB
Motif
Pfam: RasGEF cNMP_binding DEP RasGEF_N
Other DBs
NCBI-GeneID: 107499884
NCBI-ProteinID: XP_015979956
LinkDB
Position
Unknown
AA seq 923 aa
MKVGWPGESRWQVGLTVEDSPALGAPLVGSLTDVVAEGTLLNMVLRRMHRPRSCSYQLLL
EHQRPSRIQGLRWTPLTNSEESLDFSVSLEQASTERVLRAGKQLHRHLLATCPNLIRDRK
YHLRLYRQCCSGRELVDGILALGLGVHSRSQAVGICQVLLDEGALCHVKHDWTFQDRDTQ
FYRFPGPEPEPAGVHELEEELVEAMALLSQRGPDALLTVALRKSPGQRTDEELDLIFEEL
LHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSVNVVTHGKGL
VTTLHEGDDFGQLALVNDAPRAATIVLREDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHG
KVVLVLERTSQGAGPSHPPTPGRNRYTVMSGTPEKILELLLEAMRPDSSAHDPTETFLSD
FLLTHSVFMPSTQLCAALLHHFHVEPAGGSEQERSTYICNKRQQILRLVSQWVALYGPML
HTDPVASSFLQKLSELVSRDARLSNLLREQWPERRRHHRLENGCGNASPQIKARNMTAWL
PSQDEPLPSSNCAIRVGDKVSYDICRPDHSVLTLQLPVTASVREVMAALAKEDSWTKGQV
LVKVNSAGDAIGLQPEARGVATSLGLNERLFVVNPQEVHELTPHPEQLGPTVGSAEGLDL
VSAKDLAGQLTDHDWNLFNSIHQVELIHYVLGPQHLRDVTTANLERFMRRFNELQYWVAT
ELCLCAVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLARTWERLPHKV
RKLYSALERLLDPSWNHRVYRLALTKLSPPIIPFMPLLLKDMTFIHEGNHTLVENLINFE
KMRMMARAVRMLHHCRSHSNVPLSPLRSRVSHLHEDSQAVRISTCSEQSLSTRSPASTWA
YVQQLKVIDNQRELSRLSRELEP
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgaaggtgggctggccaggtgaaagccgctggcaggtgggcctgactgtggaggacagc
cctgctctgggagcaccactggtgggaagccttacagacgtggtggcagaggggaccctg
ctcaacatggtgctgaggaggatgcacaggccccgaagctgctcctaccagctgctcctg
gagcaccagcgccccagccgcattcaggggcttcgctggacgcctctcaccaacagcgag
gagtccctggatttcagtgtgagcctggagcaggcgtccacagagcgggtgctcagagct
gggaagcaactgcatcgacatctcctggccacctgcccgaacctcatccgagaccgaaag
taccatcttaggctctatcggcagtgctgttccggccgggagctggtggatgggatcttg
gccctagggctaggggtccattcccggagccaagctgtgggaatctgccaggtgctgctg
gatgaaggtgccctctgccatgtgaaacacgactggaccttccaggaccgagacacccaa
ttctaccgcttccctgggccagagccggagccagcaggagtccacgagctggaggaggag
ctggtcgaggccatggccctgctctcccagcgggggcctgacgccctgctcacagtggcg
ctgcgaaaatccccagggcagcgcacagatgaggagctggacctcatctttgaggagctg
ctacacatcaaggctgtggcccacctctccaactcggtgaagcgggaattagcggcagtt
cttctctttgaaccacacagcaaggcagggactgtattgttcagccagggggacaagggc
acctcgtggtacattatctggaaaggatctgtcaatgtggtgactcatggcaaggggctg
gtgaccacactgcatgagggagatgactttggacagctggctctcgtgaacgatgcgccc
cgagcggccaccattgtcctgagagaagacaactgtcatttcctccgcgtggacaagcag
gacttcaaccgcatcatcaaggatgtggaagcaaagaccatgaggctggaagaacatggc
aaagtggtgttggtgctggagagaacctctcagggcgctggcccttctcaccccccaacc
ccaggaaggaaccggtacacggtgatgtctggcaccccagagaagatcctggagctgctg
ctggaggccatgcggcctgactccagtgctcatgacccaacagagacattcctcagcgac
ttcctcctgacccacagcgtcttcatgcccagcacccagctctgtgctgctctcttgcac
cactttcacgtggagcccgcagggggcagtgagcaggagcgcagcacctacatctgcaac
aagaggcagcagatcctgcggttggtcagccagtgggtggccctgtatggccccatgctc
cacactgaccccgtggccagcagctttcttcagaaactctccgagctggtgagcagggat
gcccggcttagcaacctgctgcgggagcagtggccagagaggcggcggcaccacaggttg
gaaaatggctgtggaaatgcatctcctcagatcaaggcccggaacatgactgcttggctc
cccagccaggacgagcccctccccagcagcaactgtgccatccgagttggggacaaagtc
tcctatgacatctgccggccggaccactcagtactaaccctgcagctgcctgttacggcc
tcagtgagagaagtgatggcagcattggccaaggaggacagctggaccaaagggcaggtg
ctggtgaaggtcaactctgcaggtgatgccattggccttcagccagaggcccgtggtgtt
gccacatccctggggctcaacgagcggctctttgttgtcaacccacaggaagtacatgag
ctgacaccacatccagagcagctggggcccaccgttggctcagctgaggggctagacctg
gtgagcgctaaggacctggcaggccagctaacggaccatgactggaacctcttcaacagt
attcaccaggtggagctgatccactatgtgctgggcccccagcatctgcgagatgtcaca
actgccaacctggagcgcttcatgcgtcgcttcaatgagctgcagtactgggtggccacg
gagctgtgcctctgcgctgtgcctggcccacgggcccagctactcaggaagttcattaag
ctggcggctcacctcaaggaacaaaagaaccttaattccttctttgccgtcatgtttggc
ctcagcaactcggccatcagccgcctggcgcgcacctgggagaggctgccccacaaagtc
cggaagctgtactccgcccttgagaggctgctggacccttcatggaaccaccgggtgtat
cgactggctctcaccaagctctccccccctatcatccccttcatgccccttcttctcaaa
gacatgaccttcatccatgagggaaaccacaccctggtggagaatctcatcaactttgag
aagatgagaatgatggccagagctgtgcggatgctgcaccactgtcgaagccacagcaat
gtgcctctctcaccgctcagaagccgagtctcccacctccacgaggacagccaggcggtg
aggatttccacatgctcggagcagtccctgagcacccggagtccagccagcacctgggct
tatgtccagcagctgaaggtcatcgacaaccagcgggaactgtcccgcctctcccgggag
ctggagccgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505164
Entry
107505164         CDS       T06036                                 

Gene name
RAPGEF4
Definition
(RefSeq) rap guanine nucleotide exchange factor 4 isoform X1
  KO
K04351  Rap guanine nucleotide exchange factor 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04072  Phospholipase D signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04670  Leukocyte transendothelial migration
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107505164 (RAPGEF4)
   04072 Phospholipase D signaling pathway
    107505164 (RAPGEF4)
   04024 cAMP signaling pathway
    107505164 (RAPGEF4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107505164 (RAPGEF4)
  09152 Endocrine system
   04911 Insulin secretion
    107505164 (RAPGEF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107505164 (RAPGEF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107505164 (RAPGEF4)
Membrane trafficking [BR:ray04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    107505164 (RAPGEF4)
SSDB
Motif
Pfam: RasGEF cNMP_binding DEP RasGEF_N
Other DBs
NCBI-GeneID: 107505164
NCBI-ProteinID: XP_015990526
LinkDB
Position
Unknown
AA seq 1011 aa
MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGY
YENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDN
TPRHATIVTRESSELLRIEQKDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENT
PLIEPHVPLRPANTITKVPSEKILRAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTE
LVDWMLQQTPCVHSRTQAVGMWQVLVEDGVLNHVDQEHHFQDKYLFYRFLDDEHEDAPLP
TEEEKKECDEELQDTMLLLSQTGPDAHMRMILRKPPGQRTVDDLEIIYEELLHIKALSHL
STTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDD
FGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKV
PAGNRAPNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEPALNEATDSILNDFVMMHCVF
MPNTQLCPALVAHYHAQPSQGTEQEKMDYALNNKRRVIRLVLQWAAMYGDVLQEDDVAIA
FLEEFYVSVSDDARMIAAFKEQLPELEKIVKQISEDAKNPQKKHKVLLQQFNTGDERAQK
HQPIRGSDEVLFKVYCMDHTYTTIRVPVAASVKEVISAVADKLGSGESLIIVKMSSAGEK
VVLKPNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTVGTVGTFELMSSKDLAYQM
TIYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCSQPSKR
VQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLM
DPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTART
VRYCRSQPFNLDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP
NT seq 3036 nt   +upstreamnt  +downstreamnt
atggtcgctgcgcacgctgcccattcttcctcctccgccgagtggatcgcctgtctagat
aaaagaccattggaacgatccagtgaagatgtagatataatcttcacacggctgaaagaa
gttaaagcttttgagaaatttcacccaaatctccttcatcagatttgtttatgtggttat
tatgagaatctggagaaaggaataacattgtttcgtcaaggtgatattggaacaaactgg
tatgctgtcctggcaggatctttggatgttaaagtatctgaaaccagtagtcaccaggat
gcagtgaccatctgtactctgggaattggaacggccttcggagagtccattctggacaac
acaccccgccatgcaaccatcgttaccagggagagcagtgaactgctccgcatcgagcag
aaggacttcaaggctctatgggagaaatatcgacagtacatggcaggacttctggctcct
ccttatggtgttatggaaacgggctctaacaatgacaggattcctgacaaggagaacaca
cctctcattgaacctcacgttcctcttcgtcctgctaacaccattaccaaggtcccttcg
gagaagatcctcagggctggaaaaattttacgaaatgccattctctctcgagcacctcac
atgatacgagatagaaaataccacctaaagacttacagacaatgctgtgtgggcaccgag
ctggtggactggatgctgcagcagactccatgtgttcactcccgaactcaagccgttggc
atgtggcaggtcctggtggaggacggtgttctcaaccatgtggaccaggagcatcatttc
caagacaaatatttattttatcgatttctggatgatgagcacgaggatgccccattgcct
actgaggaggagaagaaggagtgcgatgaggagctccaggacaccatgcttctgctatcg
cagacaggccctgatgcccacatgagaatgattctccgcaaaccacctggccaaaggact
gtggatgacctagagattatctatgaagaactccttcacattaaagccttatcccatctt
tctaccacagtgaaacgggagttagcaggtgttctcatttttgagtctcatgccaaagga
ggaaccgtgttgtttaaccagggagaagaaggtacctcctggtacattattctaaaagga
tcagtgaacgtagtcatttatggcaagggtgtggtctgtaccctgcatgagggtgatgac
ttcggcaagttagcactagtaaatgacgccccgagagctgcctctatcgtcttgcgagaa
gataattgccatttcttaagagtagacaaggaggatttcaaccggatcctgagggacgtt
gaagcaaatacagtcagacttaaagaacatgaccaagatgtcttggtgctggagaaggtc
ccagcagggaacagggctcctaatcaaggaaactcacagcctcagcaaaagtatactgtg
atgtcaggaacacctgaaaaaattttagagcattttctagaaacaatacgcctcgagcca
gctttaaatgaagcaacagattctattttaaatgactttgttatgatgcactgtgttttt
atgccaaatacccagctttgcccagccctggtggcccattaccatgcacagccttcacaa
ggtacagagcaggagaagatggattatgcccttaacaataagcggagggtcatccgcctg
gtgttgcagtgggccgccatgtatggagacgtcctacaagaggatgacgtagctatcgct
ttcctggaggagttttatgtgtctgtatcagatgatgcccggatgatcgctgccttcaag
gagcagcttcccgagttggagaagattgtcaagcaaatttcagaagatgcaaagaatccg
caaaagaagcacaaagttcttttgcaacagttcaacacaggtgacgagagagcccagaag
caccaacctatccgggggtctgatgaagttctgtttaaggtgtattgcatggaccacacc
tatacaaccatccgggtgccggtggccgcctcggtgaaggaagtcatcagtgcagttgca
gacaaactaggctctggagaaagcctgatcatagtcaagatgagctctgccggagaaaag
gtggtgctcaaacctaatgatgtttcagtatttacgacgctcaccattaatggacgtctg
tttgcttgcccgcgagagcaattcgattcactgactcccttgccagaacaggaaggccca
actgttggaacagtgggaacttttgaactgatgagctcgaaagatttagcataccagatg
acgatttatgactgggagctcttcaactgtgtgcatgagctggagctaatctatcacaca
tttggaaggcataattttaaaaagaccacagcaaacttggatttgttcctgaggagattt
aatgaaattcagttttgggttgtcactgagatttgcctttgttcccagcccagcaagcgt
gttcagctcttaaaaaaatttattaagatagcagctcactgtaaggagtacaaaaatctg
aattccttctttgccatagtcatgggactaagtaacgttgccgtgagccgcttggcacta
acgtgggagaaactgccaagcaagttcaagaagttctatgcggagtttgaaagtttaatg
gatccttcaagaaaccacagagcctacaggctgacagtagctaagttggagcctcctctc
atccccttcatgcctttgctcattaaagatatgacatttactcatgaggggaacaagacg
ttcattgacaatctagtaaactttgaaaaaatgcgcatgattgcaaatactgccagaaca
gtgagatactgcagaagccaacctttcaatcttgacgcagctcaagctaataagaaccat
caggatgtccgaagttacgttcggcaattaaatgtgattgacaaccagagaactttatca
cagatgtcacatagattagagcctcgtcgaccatag

DBGET integrated database retrieval system