KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500005
Entry
107500005         CDS       T06036                                 

Gene name
ACHE
Definition
(RefSeq) acetylcholinesterase isoform X1
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107500005 (ACHE)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107500005 (ACHE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
    107500005 (ACHE)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     107500005 (ACHE)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ray00537]
 Enzymes
  107500005 (ACHE)
SSDB
Motif
Pfam: COesterase Abhydrolase_3
Other DBs
NCBI-GeneID: 107500005
NCBI-ProteinID: XP_015980240
LinkDB
Position
Unknown
AA seq 745 aa
MPNPPPTPRTPARANAGEAACAFTPPHRQVGSSCQRGPHPCRVACKWTAASGACACTAHS
GPNPVYPAKGKSSCLLGLAAMRPPWCPLHTLFPTSPLLLLLLFLLGGRAEHLEDPELLVT
VRGGQLRGIRLTAPGGPVSAFLGIPFAEPPVGPRRFLPPEPKQPWSGVLDATTFQSVCYQ
YVDTLYPGFEGSEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLD
VYDGRFLAQAEGTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFG
GDPMSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATLL
ARLVGCPPGGAGSNDTELVACLRTRPAQDLVDHEWHVLPQESVFRFSFVPVVDGDFLSDT
PEALINTGDFHNLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQVS
DLAAEAVVLHYTDWLHPEDPARLREAMSDVVGDHNVVCPVAQLAGRLAAQGARVYAYIFE
HRASTLSWPLWMGVPHGYEIEFIFGLPLEPSLNYTIEERAFAQRLMRYWANFARTGDPND
PGDLKAPKWPPYTGAAQQYVSLNLRPLEVRRGLRAQACAFWNGFLPKLLSATGMQGPAGK
GLDRVGEKWGRERKRREWKPSGYNPSLLPTSLGGSQLLPRPHPREGCPEAQAWPPITPPP
PPPPLRASAVVTMASSLSGLRGPLL
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgcccaacccaccccccacccccagaaccccggccagggccaacgcgggagaggctgcg
tgcgcctttacgccaccacaccggcaggtcggctcctcctgtcagcgagggccccacccc
tgtcgggtggcctgtaagtggactgcagcctctggtgcctgtgcctgcactgctcacagt
gggcctaacccagtctacccagctaagggaaagagcagctgcctgcttggcctggcagcc
atgaggcccccgtggtgtcctctgcacactctcttcccgacgtccccactccttctcctc
ctcctcttcctcctgggaggaagggcggagcacctagaggacccagagctgctagtgacg
gtgcgtgggggccagttgcggggcatccgcctaacagcccctgggggccctgtctctgct
tttctgggcatccccttcgcagagccacccgtgggcccccgtcgctttctgccgccagag
cccaagcaaccctggtcaggggtgctggatgccaccaccttccaaagtgtctgctaccaa
tacgtggacaccttgtaccctggctttgagggcagcgagatgtggaaccccaaccgtgag
ctgagtgaggactgcctctacctcaacgtgtggacaccctaccctcggcctacatctccc
acccctgtccttgtctggatctatgggggtggcttctacagtggggcctcttccttggac
gtttatgatggccgcttcctggcccaggcagaggggactgtgctggtatccatgaactac
cgggtgggagcttttggcttcctggccctaccagggagccgggaggccccaggcaatgta
ggtctcttggatcagaggctggccctgcagtgggtacaggagaatgtggcagcctttggg
ggggacccaatgtcagtgactctgtttggggaaagtgcaggtgctgcctccgtgggtatg
cacctgctgtccccacctagccggggcctgttccacagggctgtgcttcagagtggtgca
cccaatggcccctgggccacggtgggcatgggagaggcccggcgcagggccacactactg
gcccgcctcgtaggctgtcccccaggtggggctggtagcaatgatacagagttagttgcc
tgcttgcggacacggccagctcaggacctggtggaccacgagtggcacgtgctgcctcag
gaaagcgtcttccgcttctctttcgtgcctgtggtggatggagacttcctcagtgacact
cctgaggccctcatcaacactggagacttccacaacctgcaggtgctggtgggtgtggtg
aaggatgagggctcctattttctggtttacggggccccaggcttcagcaaagacaacgag
tctctcatcagccgggcccagttcctggccggggtgcgggtcggggtcccccaggtgagt
gacctggctgccgaggctgtggtcctgcattacacagactggctgcaccctgaggacccg
gcacgcctgagggaagccatgagtgatgtggtgggcgaccacaacgtcgtgtgccctgtg
gcccagctggctgggcgactggctgcccagggtgctcgggtctatgcctacatctttgaa
caccgtgcgtccacactctcctggcccctctggatgggggtgccccacggctacgagatc
gagttcatctttgggctccccttggaaccctcgctaaactacaccatcgaagagagagcc
tttgcccagcgactgatgagatactgggccaacttcgcccgcacaggggaccccaatgac
cccggggacctcaaagccccgaagtggccaccatacacgggggcagcgcagcagtatgtg
agcctgaacctgcggccgctggaggtgaggcgggggctgcgcgcccaggcctgcgctttc
tggaacggcttcctacccaaattgctcagtgccaccggtatgcaggggccggcgggcaag
gggttggacagagtaggggagaaatggggcagggagagaaaaagaagggagtggaagcca
tccgggtataacccctctcttctccccaccagcctcggaggctcccagctcctgcccagg
ccccacccacgggaaggctgccccgaggcccaggcctggcctcccattacccctcctcct
cctcctcctcctctccgggcttcagcggttgtgaccatggcctcttccctctccggcctc
agggggcccctcctctaa

DBGET integrated database retrieval system